KEGG   Mus musculus (mouse): 11596
Entry
11596             CDS       T01002                                 

Gene name
Ager, RA, RAGE
Definition
(RefSeq) advanced glycosylation end product-specific receptor
  KO
K19722  receptor for advanced glycosylation end products
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04613  Neutrophil extracellular trap formation
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05010  Alzheimer disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    11596 (Ager)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    11596 (Ager)
   05022 Pathways of neurodegeneration - multiple diseases
    11596 (Ager)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    11596 (Ager)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    11596 (Ager)
SSDB
Motif
Pfam: C2-set_2 Ig_2 Ig_3 ig I-set V-set Ig_4 Ig_5 SCF DUF2681
Other DBs
NCBI-GeneID: 11596
NCBI-ProteinID: NP_031451
MGI: 893592
Ensembl: ENSMUSG00000015452
Vega: OTTMUSG00000037074
UniProt: Q62151
Structure
PDB: 
4IM8

Position
17; 17 B1
AA seq 402 aa
MPAGTAARAWVLVLALWGAVAGGQNITARIGEPLVLSCKGAPKKPPQQLEWKLNTGRTEA
WKVLSPQGGPWDSVARILPNGSLLLPATGIVDEGTFRCRATNRRGKEVKSNYRVRVYQIP
GKPEIVDPASELTASVPNKVGTCVSEGSYPAGTLSWHLDGKLLIPDGKETLVKEETRRHP
ETGLFTLRSELTVIPTQGGTHPTFSCSFSLGLPRRRPLNTAPIQLRVREPGPPEGIQLLV
EPEGGIVAPGGTVTLTCAISAQPPPQVHWIKDGAPLPLAPSPVLLLPEVGHEDEGTYSCV
ATHPSHGPQESPPVSIRVTETGDEGPAEGSVGESGLGTLALALGILGGLGVVALLVGAIL
WRKRQPRREERKAPESQEDEEERAELNQSEEAEMPENGAGGP
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgccagcggggacagcagctagagcctgggtgctggttcttgctctatggggagctgta
gctggtggtcagaacatcacagcccggattggagagccacttgtgctaagctgtaagggg
gcccctaagaagccgccccagcagctagaatggaaactgaacacaggaagaactgaagct
tggaaggtcctctctccccagggaggcccctgggacagcgtggctcgaatcctccccaat
ggttccctcctccttccagccactggaattgtcgatgaggggactttccggtgtcgggca
actaacaggcgagggaaggaggtcaagtccaactaccgagtccgagtctaccagattcct
gggaagccagaaattgtggatcctgcctctgaactcacagccagtgtccctaataaggtg
gggacatgtgtgtctgagggaagctaccctgcagggacccttagctggcacttagatggg
aaacttctgattcccgatggcaaagaaacactcgtgaaggaagagaccaggagacaccct
gagacgggactctttacactgcggtcagagctgacagtgatccccacccaaggaggaacc
catcctaccttctcctgcagtttcagcctgggccttccccggcgcagacccctgaacaca
gcccccatccaactccgagtcagggagcctgggcctccagagggcattcagctgttggtt
gagcctgaaggtggaatagtcgctcctggtgggactgtgaccttgacctgtgccatctct
gcccagccccctcctcaggtccactggataaaggatggtgcacccttgcccctggctccc
agccctgtgctgctcctccctgaggtggggcacgaggatgagggcacctatagctgcgtg
gccacccaccctagccacggacctcaggaaagccctcctgtcagcatcagggtcacagaa
accggcgatgaggggccagctgaaggctctgtgggtgagtctgggctgggtacgctagcc
ctggccttggggatcctgggaggcctgggagtagtagccctgctcgtcggggctatcctg
tggcgaaaacgacaacccaggcgtgaggagaggaaggccccggaaagccaggaggatgag
gaggaacgtgcagagctgaatcagtcagaggaagcggagatgccagagaatggtgccggg
ggaccgtaa

DBGET integrated database retrieval system