KEGG   Mus musculus (mouse): 11600Help
Entry
11600             CDS       T01002                                 

Gene name
Angpt1, 1110046O21Rik, Ang-1, Ang1
Definition
(RefSeq) angiopoietin 1
  KO
K05465  angiopoietin 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    11600 (Angpt1)
   04015 Rap1 signaling pathway
    11600 (Angpt1)
   04010 MAPK signaling pathway
    11600 (Angpt1)
   04066 HIF-1 signaling pathway
    11600 (Angpt1)
   04151 PI3K-Akt signaling pathway
    11600 (Angpt1)
 09160 Human Diseases
  09163 Immune diseases
   05323 Rheumatoid arthritis
    11600 (Angpt1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    11600 (Angpt1)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   11600 (Angpt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fibrinogen_C
Motif
Other DBs
NCBI-GeneID: 11600
NCBI-ProteinID: NP_033770
MGI: 108448
Ensembl: ENSMUSG00000022309
UniProt: O08538
Position
15 B3.1; 15 16.69 cM
AA seq 498 aa AA seqDB search
MTVFLSFAFFAAILTHIGCSNQRRNPENGGRRYNRIQHGQCAYTFILPEHDGNCRESATE
QYNTNALQRDAPHVEPDFSSQKLQHLEHVMENYTQWLQKLENYIVENMKSEMAQIQQNAV
QNHTATMLEIGTSLLSQTAEQTRKLTDVETQVLNQTSRLEIQLLENSLSTYKLEKQLLQQ
TNEILKIHEKNSLLEHKILEMEGKHKEELDTLKEEKENLQGLVSRQTFIIQELEKQLSRA
TNNNSILQKQQLELMDTVHNLISLCTKEGVLLKGGKREEEKPFRDCADVYQAGFNKSGIY
TIYFNNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNE
FIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLIL
HGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFK
GPSYSLRSTTMMIRPLDF
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgacagttttcctttcctttgcattcttcgctgccattctgactcacatagggtgcagc
aaccagcgccgaaatccagaaaacggagggagaagatataaccggattcaacatgggcaa
tgtgcctacactttcattcttccagaacacgacgggaactgccgtgagagtgcgacagag
cagtacaacaccaacgctctgcaaagggatgctccacacgtggagccggatttctcttcc
cagaaacttcagcatctggagcatgtgatggaaaattatactcagtggctgcaaaaactt
gagaattacattgtggaaaatatgaagtcggagatggcccagatacaacagaatgctgtt
caaaaccacacggccaccatgcttgagataggaaccagtctcttatctcagactgcagag
cagacccgaaagctgacagatgttgagacccaggtactaaatcaaacatcccgacttgaa
atacaactgctagagaattcattatcaacatacaagctagagaagcaacttctccaacag
acaaatgaaattctgaagattcacgaaaaaaacagtttactagagcacaaaatcttagaa
atggagggaaaacacaaagaagaattggacaccttgaaggaggagaaagaaaaccttcaa
ggcttggtttctcgtcagacattcatcatccaggagttggagaagcaacttagtagagct
accaacaacaacagcatcctgcagaagcaacaactggagctcatggacacagttcataac
cttatcagcctttgcactaaagaaggtgttttgctaaagggaggaaaaagagaagaagag
aaaccatttcgagactgtgcagatgtatatcaagctggttttaataaaagtggaatctac
actatttattttaataatatgccagaacccaaaaaggtattttgcaatatggatgtgaat
gggggaggttggacagtaatacaacaccgggaagatggaagcctggatttccagaggggc
tggaaggagtataaaatgggttttgggaatccctctggtgaatattggcttgggaacgag
ttcatttttgcaataaccagtcagaggcagtacatgctgaggattgagctgatggactgg
gaagggaaccgagcctactcacagtacgacagattccacataggaaatgaaaagcagaac
tataggttatatttaaaaggtcacacagggacagcaggcaaacagagcagcttgatctta
cacggtgccgatttcagcacgaaggatgctgataacgacaactgtatgtgcaaatgcgct
ctcatgctaacaggaggttggtggttcgatgcctgtggcccttccaatctaaatggaatg
ttctacactgcgggacaaaatcatggaaaactgaatgggataaagtggcactacttcaaa
gggcccagttactccttacgttccaccaccatgatgatccggcccttggacttttga

DBGET integrated database retrieval system