KEGG   Mus musculus (mouse): 11600
Entry
11600             CDS       T01002                                 

Gene name
Angpt1, 1110046O21Rik, Ang, Ang-1, Ang1, an
Definition
(RefSeq) angiopoietin 1
  KO
K05465  angiopoietin 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    11600 (Angpt1)
   04014 Ras signaling pathway
    11600 (Angpt1)
   04015 Rap1 signaling pathway
    11600 (Angpt1)
   04066 HIF-1 signaling pathway
    11600 (Angpt1)
   04151 PI3K-Akt signaling pathway
    11600 (Angpt1)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    11600 (Angpt1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    11600 (Angpt1)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   11600 (Angpt1)
SSDB
Motif
Pfam: Fibrinogen_C F_actin_bind
Other DBs
NCBI-GeneID: 11600
NCBI-ProteinID: NP_033770
MGI: 108448
Ensembl: ENSMUSG00000022309
UniProt: O08538
Position
15 B3.1; 15 16.69 cM
AA seq 498 aa
MTVFLSFAFFAAILTHIGCSNQRRNPENGGRRYNRIQHGQCAYTFILPEHDGNCRESATE
QYNTNALQRDAPHVEPDFSSQKLQHLEHVMENYTQWLQKLENYIVENMKSEMAQIQQNAV
QNHTATMLEIGTSLLSQTAEQTRKLTDVETQVLNQTSRLEIQLLENSLSTYKLEKQLLQQ
TNEILKIHEKNSLLEHKILEMEGKHKEELDTLKEEKENLQGLVSRQTFIIQELEKQLSRA
TNNNSILQKQQLELMDTVHNLISLCTKEGVLLKGGKREEEKPFRDCADVYQAGFNKSGIY
TIYFNNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNE
FIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLIL
HGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFK
GPSYSLRSTTMMIRPLDF
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgacagttttcctttcctttgcattcttcgctgccattctgactcacatagggtgcagc
aaccagcgccgaaatccagaaaacggagggagaagatataaccggattcaacatgggcaa
tgtgcctacactttcattcttccagaacacgacgggaactgccgtgagagtgcgacagag
cagtacaacaccaacgctctgcaaagggatgctccacacgtggagccggatttctcttcc
cagaaacttcagcatctggagcatgtgatggaaaattatactcagtggctgcaaaaactt
gagaattacattgtggaaaatatgaagtcggagatggcccagatacaacagaatgctgtt
caaaaccacacggccaccatgcttgagataggaaccagtctcttatctcagactgcagag
cagacccgaaagctgacagatgttgagacccaggtactaaatcaaacatcccgacttgaa
atacaactgctagagaattcattatcaacatacaagctagagaagcaacttctccaacag
acaaatgaaattctgaagattcacgaaaaaaacagtttactagagcacaaaatcttagaa
atggagggaaaacacaaagaagaattggacaccttgaaggaggagaaagaaaaccttcaa
ggcttggtttctcgtcagacattcatcatccaggagttggagaagcaacttagtagagct
accaacaacaacagcatcctgcagaagcaacaactggagctcatggacacagttcataac
cttatcagcctttgcactaaagaaggtgttttgctaaagggaggaaaaagagaagaagag
aaaccatttcgagactgtgcagatgtatatcaagctggttttaataaaagtggaatctac
actatttattttaataatatgccagaacccaaaaaggtattttgcaatatggatgtgaat
gggggaggttggacagtaatacaacaccgggaagatggaagcctggatttccagaggggc
tggaaggagtataaaatgggttttgggaatccctctggtgaatattggcttgggaacgag
ttcatttttgcaataaccagtcagaggcagtacatgctgaggattgagctgatggactgg
gaagggaaccgagcctactcacagtacgacagattccacataggaaatgaaaagcagaac
tataggttatatttaaaaggtcacacagggacagcaggcaaacagagcagcttgatctta
cacggtgccgatttcagcacgaaggatgctgataacgacaactgtatgtgcaaatgcgct
ctcatgctaacaggaggttggtggttcgatgcctgtggcccttccaatctaaatggaatg
ttctacactgcgggacaaaatcatggaaaactgaatgggataaagtggcactacttcaaa
gggcccagttactccttacgttccaccaccatgatgatccggcccttggacttttga

KEGG   Mus musculus (mouse): 11601
Entry
11601             CDS       T01002                                 

Gene name
Angpt2, Agpt2, An, Ang, Ang-2, Ang2
Definition
(RefSeq) angiopoietin 2
  KO
K05466  angiopoietin 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    11601 (Angpt2)
   04014 Ras signaling pathway
    11601 (Angpt2)
   04015 Rap1 signaling pathway
    11601 (Angpt2)
   04066 HIF-1 signaling pathway
    11601 (Angpt2)
   04151 PI3K-Akt signaling pathway
    11601 (Angpt2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    11601 (Angpt2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    11601 (Angpt2)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   11601 (Angpt2)
SSDB
Motif
Pfam: Fibrinogen_C CbiJ
Other DBs
NCBI-GeneID: 11601
NCBI-ProteinID: NP_031452
MGI: 1202890
Ensembl: ENSMUSG00000031465
Vega: OTTMUSG00000036075
UniProt: O35608 B9EHQ4
Position
8 A1.3; 8 10.3 cM
AA seq 496 aa
MWQIIFLTFGWDLVLASAYSNFRKSVDSTGRRQYQVQNGPCSYTFLLPETDSCRSSSSPY
MSNAVQRDAPLDYDDSVQRLQVLENILENNTQWLMKLENYIQDNMKKEMVEIQQNVVQNQ
TAVMIEIGTSLLNQTAAQTRKLTDVEAQVLNQTTRLELQLLQHSISTNKLEKQILDQTSE
INKLQNKNSFLEQKVLDMEGKHSEQLQSMKEQKDELQVLVSKQSSVIDELEKKLVTATVN
NSLLQKQQHDLMETVNSLLTMMSSPNSKSSVAIRKEEQTTFRDCAEIFKSGLTTSGIYTL
TFPNSTEEIKAYCDMDVGGGGWTVIQHREDGSVDFQRTWKEYKEGFGSPLGEYWLGNEFV
SQLTGQHRYVLKIQLKDWEGNEAHSLYDHFYLAGEESNYRIHLTGLTGTAGKISSISQPG
SDFSTKDSDNDKCICKCSQMLSGGWWFDACGPSNLNGQYYPQKQNTNKFNGIKWYYWKGS
GYSLKATTMMIRPADF
NT seq 1491 nt   +upstreamnt  +downstreamnt
atgtggcagatcattttcctaacttttggctgggatcttgtcttggcctcagcctacagt
aactttaggaagagcgtggacagcacaggcagaaggcagtaccaggtccagaacggaccc
tgcagctacacgttcctgctgccggagaccgacagctgccgatcttcctccagcccctac
atgtccaatgccgtgcagagggatgcacccctcgactacgacgactcagtgcaaaggctg
caggtgctggagaacattctagagaacaacacacagtggctgatgaagctggagaattac
attcaggacaacatgaagaaggagatggtggagatccaacagaatgtggtgcagaaccag
acagctgtgatgatagagattggaaccagcttgctgaaccagacagcagcacaaactcgg
aaactgactgatgtggaagcccaagtactaaaccagacgacaagactcgagctgcagctt
ctccaacattctatttctaccaacaaattggaaaagcagattttggatcagaccagtgaa
ataaacaagctacaaaataagaacagcttcctagaacagaaagttctggacatggagggc
aagcacagcgagcagctacagtccatgaaggagcagaaggacgagctccaggtgctggtg
tccaagcagagctctgtcattgacgagctggagaagaagctggtgacagccacggtcaac
aactcgctccttcagaagcagcagcatgacctaatggagaccgtcaacagcttgctgacc
atgatgtcatcacccaactccaagagctcggttgctatccgtaaagaagagcaaaccacc
ttcagagactgtgcggaaatcttcaagtcaggactcaccaccagtggcatctacacactg
accttccccaactccacagaggagatcaaggcctactgtgacatggacgtgggtggagga
gggtggacagtcatccaacaccgagaagatggcagtgtggacttccagaggacgtggaaa
gaatacaaagagggcttcgggagccctctgggagagtactggctgggcaatgagtttgtc
tcccagctgaccggtcagcaccgctacgtgcttaagatccagctgaaggactgggaaggc
aacgaggcgcattcgctgtatgatcacttctacctcgctggtgaagagtccaactacagg
attcaccttacaggactcacggggaccgcgggcaaaataagtagcatcagccaaccagga
agtgattttagcacaaaggattcggacaatgacaaatgcatctgcaagtgttcccagatg
ctctcaggaggctggtggtttgacgcatgtggtccttccaacttgaatggacagtactac
ccacaaaaacagaatacaaataagtttaacggtatcaagtggtactactggaaggggtcc
ggctactcgctcaaggccacaaccatgatgatccggccagcagatttctaa

KEGG   Mus musculus (mouse): 11602
Entry
11602             CDS       T01002                                 

Gene name
Angpt4, ANG-3, ANG-4, Agpt4, Ang3
Definition
(RefSeq) angiopoietin 4
  KO
K05467  angiopoietin 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    11602 (Angpt4)
   04014 Ras signaling pathway
    11602 (Angpt4)
   04015 Rap1 signaling pathway
    11602 (Angpt4)
   04066 HIF-1 signaling pathway
    11602 (Angpt4)
   04151 PI3K-Akt signaling pathway
    11602 (Angpt4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    11602 (Angpt4)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   11602 (Angpt4)
SSDB
Motif
Pfam: Fibrinogen_C ANAPC15 MLIP
Other DBs
NCBI-GeneID: 11602
NCBI-ProteinID: NP_033771
MGI: 1336887
Ensembl: ENSMUSG00000027460
Vega: OTTMUSG00000015844
UniProt: Q9WVH6 Q3V0P7
Position
2 G3; 2 74.83 cM
AA seq 509 aa
MLCQPAMLLDGLLLLATMAAAQHRGPEAGGHRQIHQVRRGQCSYTFVVPEPDICQLAPTA
APEALGGSNSLQRDLPASRLHLTDWRAQRAQRAQRVSQLEKILENNTQWLLKLEQSIKVN
LRSHLVQAQQDTIQNQTTTMLALGANLMNQTKAQTHKLTAVEAQVLNQTLHMKTQMLENS
LSTNKLERQMLMQSRELQRLQGRNRALETRLQALEAQHQAQLNSLQEKREQLHSLLGHQT
GTLANLKHNLHALSSNSSSLQQQQQQLTEFVQRLVRIVAQDQHPVSLKTPKPVFQDCAEI
KRSGVNTSGVYTIYETNMTKPLKVFCDMETDGGGWTLIQHREDGSVNFQRTWEEYKEGFG
NVAREHWLGNEAVHRLTSRTAYLLRVELHDWEGRQTSIQYENFQLGSERQRYSLSVNDSS
SSAGRKNSLAPQGTKFSTKDMDNDNCMCKCAQMLSGGWWFDACGLSNLNGIYYSVHQHLH
KINGIRWHYFRGPSYSLHGTRMMLRPMGA
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgctctgccagccagctatgctactagatggcctcctcctgctggccaccatggctgca
gcccagcacagagggccagaagccggtgggcaccgccagattcaccaggtccggcgtggc
cagtgcagctacacctttgtggtgccggagcctgatatctgccagctggcgccgacagcg
gcgcctgaggctttggggggctccaatagcctccagagggacttgcctgcctcgaggctg
cacctaacagactggcgagcccagagggcccagcgggcccagcgtgtgagccagctggag
aagatactagagaataacactcagtggctgctgaagctggagcagtccatcaaggtgaac
ttgaggtcacacctggtgcaggcccagcaggacacaatccagaaccagacaactaccatg
ctggcactgggtgccaacctcatgaaccagaccaaagctcagacccacaagctgactgct
gtggaggcacaggtcctaaaccagacattgcacatgaagacccaaatgctggagaactca
ctgtccaccaacaagctggagcggcagatgctgatgcagagccgagagctgcagcggctg
cagggtcgcaacagggccctggagaccaggctgcaggcactggaagcacaacatcaggcc
cagcttaacagcctccaagagaagagggaacaactgcacagtctcctgggccatcagacc
gggaccctggctaacctgaagcacaatctgcacgctctcagcagcaattccagctccctg
cagcagcagcagcagcaactgacggagtttgtacagcgcctggtacggattgtagcccag
gaccagcatccggtttccttaaagacacctaagccagtgttccaggactgtgcagagatc
aagcgctccggggttaataccagcggtgtctataccatctatgagaccaacatgacaaag
cctctcaaggtgttctgtgacatggagactgatggaggtggctggaccctcatccagcac
cgggaggatggaagcgtaaatttccagaggacctgggaagaatacaaagagggttttggt
aatgtggccagagagcactggctgggcaatgaggctgtgcaccgcctcaccagcagaacg
gcctacttgctacgcgtggaactgcatgactgggaaggccgccagacctccatccagtat
gagaacttccagctgggcagcgagaggcagcggtacagcctctctgtgaatgacagcagc
agttcagcagggcgcaagaacagcctggctcctcagggcaccaagttcagcaccaaagac
atggacaatgataactgcatgtgtaaatgtgctcagatgctgtctggagggtggtggttt
gatgcctgtggcctctccaacctcaatggcatctactattcagttcatcagcacttgcac
aagatcaatggcatccgctggcactacttccgaggccccagctactcactgcacggcaca
cgcatgatgctgaggccaatgggtgcctga

KEGG   Mus musculus (mouse): 11839
Entry
11839             CDS       T01002                                 

Gene name
Areg, AR, Mcub, Sdg, Sdgf
Definition
(RefSeq) amphiregulin
  KO
K09782  amphiregulin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04390  Hippo signaling pathway
mmu05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    11839 (Areg)
   04012 ErbB signaling pathway
    11839 (Areg)
   04390 Hippo signaling pathway
    11839 (Areg)
   04151 PI3K-Akt signaling pathway
    11839 (Areg)
 09160 Human Diseases
  09162 Cancer: specific types
   05210 Colorectal cancer
    11839 (Areg)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    11839 (Areg)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    11839 (Areg)
Chaperones and folding catalysts [BR:mmu03110]
 Intramolecular chaperones
  Others
   11839 (Areg)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   11839 (Areg)
SSDB
Motif
Pfam: Rieske FtsL Pestivirus_E2 DUF2207 EGF
Other DBs
NCBI-GeneID: 11839
NCBI-ProteinID: NP_033834
MGI: 88068
Ensembl: ENSMUSG00000029378
Vega: OTTMUSG00000055520
UniProt: P31955 Q4FJT2
Position
5 E2; 5 44.78 cM
AA seq 248 aa
MRTPLLPLARSVLLLLVLGSGHYAAALELNDPSSGKGESLSGDHSAGGLELSVGREVSTI
SEMPSGSELSTGDYDYSEEYDNEPQISGYIIDDSVRVEQVIKPKKNKTEGEKSTEKPKRK
KKGGKNGKGRRNKKKKNPCTAKFQNFCIHGECRYIENLEVVTCNCHQDYFGERCGEKSMK
THSEDDKDLSKIAVVAVTIFVSAIILAAIGIGIVITVHLWKRYFREYEGETEERRRLRQE
NGTVHAIA
NT seq 747 nt   +upstreamnt  +downstreamnt
atgagaactccgctgctaccgctggcgcgctcagtgctgttgctgctggtcttaggctca
ggccattatgcagctgctttggagctcaatgaccccagctcagggaaaggcgaatcgctt
tctggggaccacagtgccggtggacttgagctttctgtgggaagagaggtttccaccata
agcgaaatgccttctggcagtgaactctccacaggggactacgactactcagaggagtat
gataatgaaccacaaatatccggctatattatagatgattcagtcagagttgaacaggtg
attaagcccaagaaaaacaagacagaaggagaaaagtctacagaaaaacccaaaaggaag
aaaaagggaggcaaaaatggaaaaggcagaaggaataagaagaaaaagaatccatgcact
gccaagtttcagaacttttgcattcatggcgaatgcagatacatcgagaacctggaggtg
gtgacatgcaattgtcatcaagattactttggtgaacggtgtggagaaaaatccatgaag
actcacagcgaggatgacaaggacctatccaagattgcagtagtagctgtcactatcttt
gtctctgccatcatcctcgcagctattggcatcggcatcgttatcacagtgcacctttgg
aaacgatacttcagggaatatgaaggagaaacagaagaaagaaggaggcttcgacaagaa
aacgggactgtgcatgccattgcctag

KEGG   Mus musculus (mouse): 12064
Entry
12064             CDS       T01002                                 

Gene name
Bdnf
Definition
(RefSeq) brain derived neurotrophic factor
  KO
K04355  brain-derived neurotrophic factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04024  cAMP signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04722  Neurotrophin signaling pathway
mmu05016  Huntington disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05030  Cocaine addiction
mmu05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    12064 (Bdnf)
   04014 Ras signaling pathway
    12064 (Bdnf)
   04024 cAMP signaling pathway
    12064 (Bdnf)
   04151 PI3K-Akt signaling pathway
    12064 (Bdnf)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    12064 (Bdnf)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    12064 (Bdnf)
   05022 Pathways of neurodegeneration - multiple diseases
    12064 (Bdnf)
  09165 Substance dependence
   05030 Cocaine addiction
    12064 (Bdnf)
   05034 Alcoholism
    12064 (Bdnf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    12064 (Bdnf)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   12064 (Bdnf)
SSDB
Motif
Pfam: NGF Spaetzle
Other DBs
NCBI-GeneID: 12064
NCBI-ProteinID: NP_001041604
MGI: 88145
Ensembl: ENSMUSG00000048482
Vega: OTTMUSG00000015122
UniProt: P21237 Q541P3
Position
2 E3; 2 56.63 cM
AA seq 249 aa
MTILFLTMVISYFGCMKAAPMKEVNVHGQGNLAYPGVRTHGTLESVNGPRAGSRGLTTTS
LADTFEHVIEELLDEDQKVRPNEENHKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLD
AANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLK
QYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCV
CTLTIKRGR
NT seq 750 nt   +upstreamnt  +downstreamnt
atgaccatccttttccttactatggttatttcatacttcggttgcatgaaggcggcgccc
atgaaagaagtaaacgtccacggacaaggcaacttggcctacccaggtgtgcggacccat
gggactctggagagcgtgaatgggcccagggcaggttcgagaggtctgacgacgacatca
ctggctgacacttttgagcacgtcatcgaagagctgctggatgaggaccagaaggttcgg
cccaacgaagaaaaccataaggacgcggacttgtacacttcccgggtgatgctcagcagt
caagtgcctttggagcctcctctactctttctgctggaggaatacaaaaattacctggat
gccgcaaacatgtctatgagggttcggcgccactccgaccctgcccgccgtggggagctg
agcgtgtgtgacagtattagcgagtgggtcacagcggcagataaaaagactgcagtggac
atgtctggcgggacggtcacagtcctagagaaagtcccggtatccaaaggccaactgaag
cagtatttctacgagaccaagtgtaatcccatgggttacaccaaggaaggctgcaggggc
atagacaaaaggcactggaactcgcaatgccgaactacccaatcgtatgttcgggccctt
actatggatagcaaaaagagaattggctggcgattcataaggatagacacttcctgtgta
tgtacactgaccattaaaaggggaagatag

KEGG   Mus musculus (mouse): 12977
Entry
12977             CDS       T01002                                 

Gene name
Csf1, C87615, CSF-, Csf, Csfm, M-CS, MCSF, op
Definition
(RefSeq) colony stimulating factor 1 (macrophage)
  KO
K05453  macrophage colony-stimulating factor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04151  PI3K-Akt signaling pathway
mmu04380  Osteoclast differentiation
mmu04640  Hematopoietic cell lineage
mmu04668  TNF signaling pathway
mmu05010  Alzheimer disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    12977 (Csf1)
   04014 Ras signaling pathway
    12977 (Csf1)
   04015 Rap1 signaling pathway
    12977 (Csf1)
   04668 TNF signaling pathway
    12977 (Csf1)
   04151 PI3K-Akt signaling pathway
    12977 (Csf1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12977 (Csf1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    12977 (Csf1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    12977 (Csf1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    12977 (Csf1)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    12977 (Csf1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    12977 (Csf1)
   05022 Pathways of neurodegeneration - multiple diseases
    12977 (Csf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    12977 (Csf1)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  CSF and other factors
   12977 (Csf1)
SSDB
Motif
Pfam: CSF-1
Other DBs
NCBI-GeneID: 12977
NCBI-ProteinID: NP_001107002
MGI: 1339753
Ensembl: ENSMUSG00000014599
Vega: OTTMUSG00000026573
UniProt: P07141
Structure
PDB: 
3EJJ 3UF5 4ADQ

Position
3 F2.3; 3 46.83 cM
AA seq 552 aa
MTARGAAGRCPSSTWLGSRLLLVCLLMSRSIAKEVSEHCSHMIGNGHLKVLQQLIDSQME
TSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLN
SCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSS
RDVVTKPDCNCLYPKATPSSDPASASPHQPPAPSMAPLAGLAWDDSQRTEGSSLLPSELP
LRIEDPGSAKQRPPRSTCQTLESTEQPNHGDRLTEDSQPHPSAGGPVPGVEDILESSLGT
NWVLEEASGEASEGFLTQEAKFSPSTPVGGSIQAETDRPRALSASPFPKSTEDQKPVDIT
DRPLTEVNPMRPIGQTQNNTPEKTDGTSTLREDHQEPGSPHIATPNPQRVSNSATPVAQL
LLPKSHSWGIVLPLGELEGKRSTRDRRSPAELEGGSASEGAARPVARFNSIPLTDTGHVE
QHEGSSDPQIPESVFHLLVPGIILVLLTVGGLLFYKWKWRSHRDPQTLDSSVGRPEDSSL
TQDEDRQVELPV
NT seq 1659 nt   +upstreamnt  +downstreamnt
atgaccgcgcggggcgccgcggggcgctgcccttcttcgacatggctgggctcccggctg
ctgctggtctgtctcctcatgagcaggagtattgccaaggaggtgtcagaacactgtagc
cacatgattgggaatggacacctgaaggtcctgcagcagttgatcgacagtcaaatggag
acttcatgccagattgcctttgaatttgtagaccaggaacagctggatgatcctgtttgc
tacctaaagaaggccttttttctggtacaagacataatagatgagaccatgcgctttaaa
gacaacacccccaatgctaacgccaccgagaggctccaggaactctccaataacctgaac
agctgcttcaccaaggactatgaggagcagaacaaggcctgtgtccgaactttccatgag
actcctctccagctgctggagaagatcaagaacttctttaatgaaacaaagaatctcctt
gaaaaggactggaacatttttaccaagaactgcaacaacagctttgctaagtgctctagc
cgagatgtggtgaccaagcctgattgcaactgcctgtaccctaaagccacccctagcagt
gacccggcctctgcctcccctcaccagccccccgccccctccatggcccctctggctggc
ttggcttgggatgattctcagaggacagagggcagctccctcttgcccagtgagcttccc
cttcgcatagaggacccaggcagtgccaagcagcgaccacccaggagtacctgccagacc
ctcgagtcaacagagcaaccaaaccatggggacagactcactgaggactcacaacctcat
ccttctgcgggggggcccgtccctggggtggaagacattcttgaatcttcactgggcact
aactgggtcctagaagaagcttctggagaggctagtgagggatttttgacccaggaagca
aagttttccccctccacgcctgtagggggcagcatccaggcagagactgacagacccagg
gccctctcagcatctccattccctaaatcaacagaggaccaaaagccagtggatataaca
gacaggccgttgacagaggtgaaccctatgagacccattggccagacacagaataatact
cctgagaagactgatggtacatccacgctgcgtgaagaccaccaggagccaggctctccc
catattgcgacaccgaatccccaacgagtcagcaactcagccacccccgttgctcagtta
ctgcttcccaaaagccactcttggggcattgtgctgccccttggggagcttgagggcaag
agaagtaccagggatcgaaggagccccgcagagctggaaggaggatcagcaagtgagggg
gcagccaggcctgtggcccgttttaattccattcctttgactgacacaggccatgtggag
cagcatgagggatcctctgacccccagatccctgagtctgtcttccacctgctggtgccg
ggcatcatcctagtcttgctgactgttgggggcctcctgttctacaagtggaagtggagg
agccatcgagaccctcagacattggattcttctgtggggcgaccagaggacagctccctg
acccaggatgaggacagacaggtggaactgccagtatag

KEGG   Mus musculus (mouse): 13636
Entry
13636             CDS       T01002                                 

Gene name
Efna1, AI325262, B61, EFL-, Efl1, Ep, Epl, Epl1, Eplg1, LERK, Ler, Lerk1
Definition
(RefSeq) ephrin A1
  KO
K05462  ephrin-A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04360  Axon guidance
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    13636 (Efna1)
   04014 Ras signaling pathway
    13636 (Efna1)
   04015 Rap1 signaling pathway
    13636 (Efna1)
   04151 PI3K-Akt signaling pathway
    13636 (Efna1)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    13636 (Efna1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    13636 (Efna1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    13636 (Efna1)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    13636 (Efna1)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   13636 (Efna1)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Axon guidance molecules
   13636 (Efna1)
SSDB
Motif
Pfam: Ephrin
Other DBs
NCBI-GeneID: 13636
NCBI-ProteinID: NP_034237
MGI: 103236
Ensembl: ENSMUSG00000027954
Vega: OTTMUSG00000028819
UniProt: P52793 Q9D7K8
Position
3 F1; 3 39.04 cM
AA seq 205 aa
MEFLWAPLLGLCCSLAAADRHIVFWNSSNPKFREEDYTVHVQLNDYLDIICPHYEDDSVA
DAAMERYTLYMVEHQEYVACQPQSKDQVRWNCNRPSAKHGPEKLSEKFQRFTPFILGKEF
KEGHSYYYISKPIYHQESQCLKLKVTVNGKITHNPQAHVNPQEKRLQADDPEVQVLHSIG
YSAAPRLFPLVWAVLLLPLLLLQSQ
NT seq 618 nt   +upstreamnt  +downstreamnt
atggagttcctttgggcccctctcttgggtctgtgctgcagtctggccgctgctgaccgc
cacatcgtcttctggaacagttcaaatcccaagttccgtgaggaggactacacggtgcac
gtgcagctgaatgactacctagacatcatctgcccacattacgaggacgactctgtggca
gatgcagccatggagcgatacacactgtacatggtggaacaccaggagtatgtggcatgc
caaccccagtccaaggaccaggtccgttggaattgcaaccggcccagtgccaagcatggc
ccggagaagctgtctgagaaattccagcgcttcacgccttttatcttgggcaaggagttc
aaggaaggacacagctactactacatctccaaacctatctaccatcaggaatcccagtgc
ttgaagctgaaggtgactgtcaatggcaaaatcactcataatccccaggcccatgtcaac
ccacaggagaagagactccaagcagatgacccggaagtacaggttttgcacagcattggt
tacagtgccgccccccgcctcttcccactggtctgggcagtattgctcctaccactgctg
ctgctgcaatctcagtga

KEGG   Mus musculus (mouse): 13637
Entry
13637             CDS       T01002                                 

Gene name
Efna2, CEK7L, Cek7-, Elf-, Elf1, Ep, Ephr, Epl6, Eplg6, LERK, Lerk6
Definition
(RefSeq) ephrin A2
  KO
K05462  ephrin-A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04360  Axon guidance
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    13637 (Efna2)
   04014 Ras signaling pathway
    13637 (Efna2)
   04015 Rap1 signaling pathway
    13637 (Efna2)
   04151 PI3K-Akt signaling pathway
    13637 (Efna2)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    13637 (Efna2)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    13637 (Efna2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    13637 (Efna2)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    13637 (Efna2)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   13637 (Efna2)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Axon guidance molecules
   13637 (Efna2)
SSDB
Motif
Pfam: Ephrin
Other DBs
NCBI-GeneID: 13637
NCBI-ProteinID: NP_031935
MGI: 102707
Ensembl: ENSMUSG00000003070
Vega: OTTMUSG00000000009
UniProt: P52801 Q3USB4
Position
10 C1; 10 39.72 cM
AA seq 209 aa
MAPAQRPLLPLLLLLLPLRARNEDPARANADRYAVYWNRSNPRFQVSAVGDGGGYTVEVS
INDYLDIYCPHYGAPLPPAERMERYILYMVNGEGHASCDHRQRGFKRWECNRPAAPGGPL
KFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNLVDRPCLRLKVYVRPTNETLYEAPEPI
FTSNSSCSGLGGCHLFLTTVPVLWSLLGS
NT seq 630 nt   +upstreamnt  +downstreamnt
atggcgcccgcgcagcgcccgctgctgccgctgctgctgctgctgctgccgctgcgtgcg
cgcaacgaggacccggcccgggccaacgctgaccgatacgcagtctactggaaccgtagc
aaccccaggtttcaggtgagcgctgtgggtgatggcggcggctataccgtggaggtgagc
atcaacgactacctggatatctactgcccacactacggggcgccgctgcccccggctgag
cgcatggagcggtacatcctgtacatggtgaatggtgagggccacgcctcctgtgaccac
cggcagcgaggcttcaagcgctgggaatgcaaccggcccgcagcgcccgggggacccctc
aagttctcagagaagttccaactcttcacccccttttccctgggctttgagttccggcct
ggccacgaatactactacatctctgccacacctcccaacctcgtggaccgaccctgcctg
cgactcaaggtttatgtgcgtccaaccaatgagaccctgtatgaggctccagagcccatc
ttcaccagtaacagctcctgcagcggcctgggtggctgccacctcttcctcaccaccgtc
cctgtgctgtggtcccttctgggctcctag

KEGG   Mus musculus (mouse): 13638
Entry
13638             CDS       T01002                                 

Gene name
Efna3, AW494418, EFL-, EFL-2, Ehk1-, Ehk1-L, Ep, Epl3, LERK, LERK-3
Definition
(RefSeq) ephrin A3
  KO
K05462  ephrin-A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04360  Axon guidance
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    13638 (Efna3)
   04014 Ras signaling pathway
    13638 (Efna3)
   04015 Rap1 signaling pathway
    13638 (Efna3)
   04151 PI3K-Akt signaling pathway
    13638 (Efna3)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    13638 (Efna3)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    13638 (Efna3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    13638 (Efna3)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    13638 (Efna3)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   13638 (Efna3)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Axon guidance molecules
   13638 (Efna3)
SSDB
Motif
Pfam: Ephrin
Other DBs
NCBI-GeneID: 13638
NCBI-ProteinID: NP_034238
MGI: 106644
Ensembl: ENSMUSG00000028039
Vega: OTTMUSG00000028865
UniProt: O08545
Position
3 F1; 3 39.06 cM
AA seq 230 aa
MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLD
IYCPHYNSSGPGGGAEQYVLYMVNLSGYRTCNASQGSKRWECNRQHASHSPIKFSEKFQR
YSAFSLGYEFHAGQEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGP
NVKINVLEDFEGENPQVPKLEKSISGTSPKREHLPLAVGIAFFLMTLLAS
NT seq 693 nt   +upstreamnt  +downstreamnt
atggcggcggctccgctgctgctgctgctgctgctcgtgcccgtgccgctgctgccgctg
ctggcccaggggcctgggggcgcactgggaaaccggcatgcggtatactggaacagctcc
aatcagcacctgcggcgagagggctacaccgtgcaggtgaacgtgaacgactatctggat
atttactgtccgcactacaacagctcagggcctggcggcggggcggagcagtacgtgctg
tacatggtgaacctgagcggctaccgcacctgcaacgccagccaaggctccaagcgctgg
gaatgcaaccggcagcacgcctcgcacagccccatcaagttctccgagaagttccagcgt
tacagcgccttctcgctgggctatgaattccatgccggccaagaatactactacatctcc
acgcccactcacaacctgcactggaagtgtctgaggatgaaggtgttcgtctgctgcgcc
tccacatcgcactccggggagaagccggtccccactctcccccagttcaccatgggcccc
aatgtgaagatcaacgtgttggaagactttgagggagagaatccccaggtgcccaagctt
gagaagagcatcagtgggaccagccccaagcgggaacacctgcctctggccgtgggcatc
gccttcttcctcatgacgctcttggcctcctag

KEGG   Mus musculus (mouse): 13639
Entry
13639             CDS       T01002                                 

Gene name
Efna4, EFL-, EFL-4, Ep, Epl4, LERK, LERK-4
Definition
(RefSeq) ephrin A4
  KO
K05462  ephrin-A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04360  Axon guidance
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    13639 (Efna4)
   04014 Ras signaling pathway
    13639 (Efna4)
   04015 Rap1 signaling pathway
    13639 (Efna4)
   04151 PI3K-Akt signaling pathway
    13639 (Efna4)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    13639 (Efna4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    13639 (Efna4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    13639 (Efna4)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    13639 (Efna4)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   13639 (Efna4)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Axon guidance molecules
   13639 (Efna4)
SSDB
Motif
Pfam: Ephrin
Other DBs
NCBI-GeneID: 13639
NCBI-ProteinID: NP_031936
MGI: 106643
Ensembl: ENSMUSG00000028040
Vega: OTTMUSG00000022077
UniProt: O08542 Q3UQB5 Q9CZS8
Position
3 F1; 3 39.07 cM
AA seq 206 aa
MRLLPLLRTVLWAALLGSRLPGCSSLRHPIYWNSSNPRLLRGDAVVELGFNDYLDIFCPH
YESPGPPEGPETFALYMVDWSGYEACTAEGANAFQRWNCSMPFAPFSPVRFSEKIQRYTP
FPLGFEFLPGETYYYISVPTPESPGRCLRLQVSVCCKESGSSHESAHPVGSPGESGTSGW
RGGHAPSPLCLLLLLLLPILRLLRVL
NT seq 621 nt   +upstreamnt  +downstreamnt
atgcggctgctgcccctgctgcggactgtgctctgggccgcgctgctcggctcgcgcctg
ccggggtgctccagcctccgccacccaatctactggaactcctctaaccccaggttgctc
cgaggagatgccgtggtggagctgggcttcaacgattacctagacatcttctgcccacat
tatgaaagcccagggcccccagaaggcccggaaacctttgcattatacatggtggactgg
tcaggctacgaggcctgcacggcagagggggcaaatgccttccagcgctggaattgctcg
atgccttttgcccctttcagccctgttcgattctcagaaaagattcagcgctacacaccc
ttcccgctgggctttgagttcttgcctggagagacttactactacatctcggtgccgact
ccggagagtcctggccggtgcctgagactccaggtgtctgtctgctgcaaggagagcggg
tcatcacatgagtcagctcatcctgttgggagtcctggagaaagcggtacgtccgggtgg
cggggaggacacgcgcccagccccctgtgtctcttgctgctgctgctgctcccaatcctc
cgtctcctgagagttctgtga

KEGG   Mus musculus (mouse): 13640
Entry
13640             CDS       T01002                                 

Gene name
Efna5, AL, AL-1, AV158822, EFL-, EFL-5, Ep, Ephr, Ephrin-A5, Epl7, LERK, LERK-7, R, RAGS
Definition
(RefSeq) ephrin A5
  KO
K05462  ephrin-A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04360  Axon guidance
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    13640 (Efna5)
   04014 Ras signaling pathway
    13640 (Efna5)
   04015 Rap1 signaling pathway
    13640 (Efna5)
   04151 PI3K-Akt signaling pathway
    13640 (Efna5)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    13640 (Efna5)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    13640 (Efna5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    13640 (Efna5)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    13640 (Efna5)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   13640 (Efna5)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Axon guidance molecules
   13640 (Efna5)
SSDB
Motif
Pfam: Ephrin
Other DBs
NCBI-GeneID: 13640
NCBI-ProteinID: NP_997537
MGI: 107444
Ensembl: ENSMUSG00000048915
Vega: OTTMUSG00000030233
UniProt: O08543
Structure
PDB: 
1SHX 1SHW

Position
17 E1.1; 17 32.57 cM
AA seq 228 aa
MLHVEMLTLLFLVLWMCVFSQDPGSKVVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDV
FCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQL
FTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDK
VENSLEPADDTVHESAEPSRGENAAQTPRIPSRLLAILLFLLAMLLTL
NT seq 687 nt   +upstreamnt  +downstreamnt
atgttgcacgtggagatgttgacgctgctctttctggtgctctggatgtgtgtgttcagc
caggacccgggctccaaagtcgtcgccgaccgctacgccgtctactggaacagcagcaac
cccagattccagaggggtgactaccacattgatgtctgtatcaatgactacctggatgtt
ttctgccctcactatgaggactctgtcccagaagacaagactgagcgctacgtcctgtac
atggtgaattttgatgggtacagtgcctgcgaccacacgtccaaagggttcaagagatgg
gaatgtaaccggcctcactccccaaacggaccgctgaagttctcggaaaaattccagctc
ttcactcccttttctttaggatttgaattcaggccaggccgagagtatttctacatctcc
tctgcaatcccagacaacggaagaaggtcctgtctaaagctcaaagtctttgtgagacca
acaaatagctgtatgaaaactataggtgttcatgatcgtgttttcgatgttaacgacaaa
gtagaaaattcattagaaccagcagatgacaccgtacatgagtcagccgagccatcccgc
ggtgagaacgcggcgcagacaccaaggatacccagccgccttttggcaatcctactgttc
ctcctggcgatgcttttgacattatag

KEGG   Mus musculus (mouse): 13645
Entry
13645             CDS       T01002                                 

Gene name
Egf, AI790464
Definition
(RefSeq) epidermal growth factor
  KO
K04357  epidermal growth factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04540  Gap junction
mmu04630  JAK-STAT signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05160  Hepatitis C
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05210  Colorectal cancer
mmu05212  Pancreatic cancer
mmu05213  Endometrial cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05219  Bladder cancer
mmu05223  Non-small cell lung cancer
mmu05224  Breast cancer
mmu05226  Gastric cancer
mmu05231  Choline metabolism in cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    13645 (Egf)
   04012 ErbB signaling pathway
    13645 (Egf)
   04014 Ras signaling pathway
    13645 (Egf)
   04015 Rap1 signaling pathway
    13645 (Egf)
   04630 JAK-STAT signaling pathway
    13645 (Egf)
   04066 HIF-1 signaling pathway
    13645 (Egf)
   04068 FoxO signaling pathway
    13645 (Egf)
   04020 Calcium signaling pathway
    13645 (Egf)
   04072 Phospholipase D signaling pathway
    13645 (Egf)
   04151 PI3K-Akt signaling pathway
    13645 (Egf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    13645 (Egf)
   04540 Gap junction
    13645 (Egf)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    13645 (Egf)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    13645 (Egf)
   05231 Choline metabolism in cancer
    13645 (Egf)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    13645 (Egf)
  09162 Cancer: specific types
   05210 Colorectal cancer
    13645 (Egf)
   05212 Pancreatic cancer
    13645 (Egf)
   05226 Gastric cancer
    13645 (Egf)
   05214 Glioma
    13645 (Egf)
   05218 Melanoma
    13645 (Egf)
   05219 Bladder cancer
    13645 (Egf)
   05215 Prostate cancer
    13645 (Egf)
   05213 Endometrial cancer
    13645 (Egf)
   05224 Breast cancer
    13645 (Egf)
   05223 Non-small cell lung cancer
    13645 (Egf)
  09172 Infectious disease: viral
   05160 Hepatitis C
    13645 (Egf)
   05165 Human papillomavirus infection
    13645 (Egf)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    13645 (Egf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    13645 (Egf)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   13645 (Egf)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition EGF_CA cEGF EGF EGF_3 DUF5050 SGL Plasmod_Pvs28 EGF_MSP1_1 hEGF Tr-sialidase_C
Other DBs
NCBI-GeneID: 13645
NCBI-ProteinID: NP_034243
MGI: 95290
Ensembl: ENSMUSG00000028017
Vega: OTTMUSG00000054128
UniProt: P01132 Q3UWD7
Structure
PDB: 

Position
3 G3; 3 58.5 cM
AA seq 1217 aa
MPWGRRPTWLLLAFLLVFLKISILSVTAWQTGNCQPGPLERSERSGTCAGPAPFLVFSQG
KSISRIDPDGTNHQQLVVDAGISADMDIHYKKERLYWVDVERQVLLRVFLNGTGLEKVCN
VERKVSGLAIDWIDDEVLWVDQQNGVITVTDMTGKNSRVLLSSLKHPSNIAVDPIERLMF
WSSEVTGSLHRAHLKGVDVKTLLETGGISVLTLDVLDKRLFWVQDSGEGSHAYIHSCDYE
GGSVRLIRHQARHSLSSMAFFGDRIFYSVLKSKAIWIANKHTGKDTVRINLHPSFVTPGK
LMVVHPRAQPRTEDAAKDPDPELLKQRGRPCRFGLCERDPKSHSSACAEGYTLSRDRKYC
EDVNECATQNHGCTLGCENTPGSYHCTCPTGFVLLPDGKQCHELVSCPGNVSKCSHGCVL
TSDGPRCICPAGSVLGRDGKTCTGCSSPDNGGCSQICLPLRPGSWECDCFPGYDLQSDRK
SCAASGPQPLLLFANSQDIRHMHFDGTDYKVLLSRQMGMVFALDYDPVESKIYFAQTALK
WIERANMDGSQRERLITEGVDTLEGLALDWIGRRIYWTDSGKSVVGGSDLSGKHHRIIIQ
ERISRPRGIAVHPRARRLFWTDVGMSPRIESASLQGSDRVLIASSNLLEPSGITIDYLTD
TLYWCDTKRSVIEMANLDGSKRRRLIQNDVGHPFSLAVFEDHLWVSDWAIPSVIRVNKRT
GQNRVRLQGSMLKPSSLVVVHPLAKPGADPCLYRNGGCEHICQESLGTARCLCREGFVKA
WDGKMCLPQDYPILSGENADLSKEVTSLSNSTQAEVPDDDGTESSTLVAEIMVSGMNYED
DCGPGGCGSHARCVSDGETAECQCLKGFARDGNLCSDIDECVLARSDCPSTSSRCINTEG
GYVCRCSEGYEGDGISCFDIDECQRGAHNCGENAACTNTEGGYNCTCAGRPSSPGLSCPD
STAPSLLGEDGHHLDRNSYPGCPSSYDGYCLNGGVCMHIESLDSYTCNCVIGYSGDRCQT
RDLRWWELRHAGYGQKHDIMVVAVCMVALVLLLVLGMWGTYYYRTRKQLSNPPKNPCDEP
SGSVSSSGPNSSSGAAVASCPQPWFVVLEKHQDPKNGSLPADGTNGAVVDAGLSPSLQLG
SVHLTSWRQKPHIDGMGTGQSCWIPPSSDRGPQEIEGNSHLPSYRPVGPEKLHSLQSANG
SCHERAPDLPRQTEPVQ
NT seq 3654 nt   +upstreamnt  +downstreamnt
atgccctggggccgaaggccaacctggctgttgctcgccttcctgctggtgtttttaaag
attagcatactcagcgtcacagcatggcagaccgggaactgtcagccaggtcctctcgag
agaagcgagagaagcgggacttgtgccggtcctgcccccttcctagttttctcacaagga
aagagcatctctcggattgacccagatggaacaaatcaccagcaattggtggtggatgct
ggcatctcagcagacatggatattcattataaaaaagagagactctattgggtggatgta
gaaagacaagttttgctaagagttttccttaacgggacaggactagagaaagtgtgcaat
gtagagaggaaggtgtctgggctggccatagactggatagatgatgaagttctctgggta
gaccaacagaacggagtcatcaccgtaacagatatgacagggaaaaattcccgagttctt
ctaagttccttaaaacatccgtcaaatatagcagtggatccaatagagaggttgatgttt
tggtcttcagaggtgaccggcagccttcacagagcacacctcaaaggtgttgatgtaaaa
acactgctggagacagggggaatatcggtgctgactctggatgtcctggacaaacggctc
ttctgggttcaggacagtggcgaaggaagccacgcttacattcattcctgtgattatgag
ggtggctccgtccgtcttatcaggcatcaagcacggcacagtttgtcttcaatggccttt
tttggtgatcggatcttctactcagtgttgaaaagcaaggcgatttggatagccaacaaa
cacacggggaaggacacggtcaggattaacctccatccatcctttgtgacacctggaaaa
ctgatggtagtacaccctcgtgcacagcccaggacagaggacgctgctaaggatcctgac
cccgaacttctcaaacagaggggaagaccatgccgcttcggtctctgtgagcgagacccc
aagtcccactcgagcgcatgcgctgagggctacacgttaagccgagaccggaagtactgc
gaagatgtcaatgaatgtgccactcagaatcacggctgtactcttgggtgtgaaaacacc
cctggatcctatcactgcacatgccccacaggatttgttctgcttcctgatgggaaacaa
tgtcacgaacttgtttcctgcccaggcaacgtatcaaagtgcagtcatggctgtgtcctg
acatcagatggtccccggtgcatctgtcctgcaggttcagtgcttgggagagatgggaag
acttgcactggttgttcatcgcctgacaatggtggatgcagccagatctgtcttcctctc
aggccaggatcctgggaatgtgattgctttcctgggtatgacctacagtcagaccgaaag
agctgtgcagcttcaggaccacagccacttttactgtttgcaaattcccaggacatccga
cacatgcattttgatggaacagactacaaagttctgctcagccggcagatgggaatggtt
tttgccttggattatgaccctgtggaaagcaagatatattttgcacagacagccctgaag
tggatagagagggctaatatggatgggtcccagcgagaaagactgatcacagaaggagta
gatacgcttgaaggtcttgccctggactggattggccggagaatctactggacagacagt
gggaagtctgttgttggagggagcgatctgagcgggaagcatcatcgaataatcatccag
gagagaatctcgaggccgcgaggaatagctgtgcatccaagggccaggagactgttctgg
acggacgtagggatgtctccacggattgaaagcgcttcccttcaaggttccgaccgggtg
ctgatagccagctccaatctactggaacccagtggaatcacgattgactacttaacagac
actttgtactggtgtgacaccaagaggtctgtgattgaaatggccaatctggatggctcc
aaacgccgaagacttatccagaacgacgtaggtcaccccttctctctagccgtgtttgag
gatcacctgtgggtctcggattgggctatcccatcggtaataagggtgaacaagaggact
ggccaaaacagggtacgtcttcaaggcagcatgctgaagccctcgtcactggttgtggtc
catccattggcaaaaccaggtgcagatccctgcttatacaggaatggaggctgtgaacac
atctgccaagagagcctgggcacagctcggtgtttgtgtcgtgaaggttttgtgaaggcc
tgggatgggaaaatgtgtctccctcaggattatccaatcctgtcaggtgaaaatgctgat
cttagtaaagaggtgacatcactgagcaactccactcaggctgaagtaccagacgatgat
gggacagaatcttccacactagtggctgaaatcatggtgtcaggcatgaactatgaagat
gactgtggtcccggggggtgtggaagccatgctcgatgcgtttcagacggagagactgct
gagtgtcagtgtctgaaagggtttgccagggatggaaacctgtgttctgatatagatgag
tgtgtgctggctagatcggactgccccagcacctcgtccaggtgcatcaacactgaaggt
ggctacgtctgcagatgctcagaaggctacgaaggagacgggatctcctgtttcgatatt
gacgagtgccagcggggggcgcacaactgcggtgagaatgccgcctgcaccaacacggag
ggaggctacaactgcacctgcgcaggccgcccatcctcgcccggactgagttgccctgac
tctaccgcaccctctctccttggggaagatggccaccatttggaccgaaatagttatcca
ggatgcccatcctcatatgatggatactgcctcaatggtggcgtgtgcatgcatattgaa
tcactggacagctacacatgcaactgtgttattggctattctggggatcgatgccagact
cgagacctacgatggtgggaactgcgtcatgctggctacgggcagaagcatgacatcatg
gtggtggctgtctgcatggtggcactggtcctgctgctcgtcttggggatgtgggggact
tactactacaggactcggaagcagctatcaaaccccccaaagaacccttgtgatgagcca
agcggaagtgtgagcagcagcggacccaacagcagcagcggggcagctgtggcttcttgt
ccccaaccttggtttgtggtcctagagaaacaccaagaccccaagaatgggagtctgcct
gcggatggtacgaatggtgcagtagtagatgctggcctgtctccctccctgcagctcggg
tcagtgcatctgacttcatggagacagaagccccacatagatggaatgggcacagggcaa
agctgctggattccaccatcaagtgacagaggaccccaggaaatagagggaaactcccac
ctaccctcctacagacctgtggggccggagaagctgcattctctccagtcagctaatgga
tcgtgtcacgaaagggctccagacctgccacggcagacagagccagttcagtag

KEGG   Mus musculus (mouse): 13874
Entry
13874             CDS       T01002                                 

Gene name
Ereg, E, EPR
Definition
(RefSeq) epiregulin
  KO
K09784  epiregulin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    13874 (Ereg)
   04012 ErbB signaling pathway
    13874 (Ereg)
   04151 PI3K-Akt signaling pathway
    13874 (Ereg)
 09160 Human Diseases
  09162 Cancer: specific types
   05210 Colorectal cancer
    13874 (Ereg)
SSDB
Motif
Pfam: EGF EGF_2 Sigma_reg_N
Other DBs
NCBI-GeneID: 13874
NCBI-ProteinID: NP_031976
MGI: 107508
Ensembl: ENSMUSG00000029377
Vega: OTTMUSG00000055519
UniProt: Q61521
Position
5; 5 E1
AA seq 162 aa
METLPASWVLTLLCLGSHLLQAVISTTVIPSCIPGESEDNCTALVQMEDDPRVAQVQITK
CSSDMDGYCLHGQCIYLVDMREKFCRCEVGYTGLRCEHFFLTVHQPLSKEYVALTVILIF
LFLIITAGCIYYFCRWYKNRKSKKSREEYERVTSGDPVLPQV
NT seq 489 nt   +upstreamnt  +downstreamnt
atggagacgctccctgcctcttgggtcttgacgctgctttgtctaggttcccaccttcta
caggcagttatcagcacaaccgtgatcccatcatgcatcccaggagaatccgaggataac
tgtaccgccttagttcagatggaagacgatccccgtgtggctcaagtgcagattacaaag
tgtagttctgacatggacggctactgcttgcatggccagtgcatctacctggtggacatg
agagagaaattctgcagatgtgaagtgggctacactggtctgcgatgtgagcacttcttt
ctaactgttcaccaacccttgagcaaagaatacgttgcgttgacagtgattctcattttc
ctgtttctcatcataaccgctggatgcatatactatttctgcagatggtacaaaaatcga
aaaagtaaaaaatcgagggaggaatatgagagagtgacctcaggggacccagtgctgcca
caggtctga

KEGG   Mus musculus (mouse): 14164
Entry
14164             CDS       T01002                                 

Gene name
Fgf1, Dffrx, Fam, Fgf, Fgf-1, Fgfa
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04390  Hippo signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14164 (Fgf1)
   04014 Ras signaling pathway
    14164 (Fgf1)
   04015 Rap1 signaling pathway
    14164 (Fgf1)
   04390 Hippo signaling pathway
    14164 (Fgf1)
   04020 Calcium signaling pathway
    14164 (Fgf1)
   04151 PI3K-Akt signaling pathway
    14164 (Fgf1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14164 (Fgf1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14164 (Fgf1)
  09162 Cancer: specific types
   05226 Gastric cancer
    14164 (Fgf1)
   05218 Melanoma
    14164 (Fgf1)
   05224 Breast cancer
    14164 (Fgf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    14164 (Fgf1)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    14164 (Fgf1)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   14164 (Fgf1)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   14164 (Fgf1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 14164
NCBI-ProteinID: NP_034327
MGI: 95515
Ensembl: ENSMUSG00000036585
Vega: OTTMUSG00000020317
UniProt: P61148 Q6ZWS1
Position
18 B3; 18 20.74 cM
AA seq 155 aa
MAEGEITTFAALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggggagatcacaaccttcgcagccctgaccgagaggttcaacctgcctcta
ggaaactacaaaaagcccaaactgctctactgcagcaacgggggccacttcttgaggatc
cttcctgatggcaccgtggatgggacaagggacaggagcgaccagcacattcagctgcag
ctcagtgcggaaagtgcgggcgaagtgtatataaagggtacggagaccggccagtacttg
gccatggacaccgaagggcttttatacggctcgcagacaccaaatgaggaatgtctgttc
ctggaaaggctggaagaaaaccattataacacttacacctccaagaagcatgcggagaag
aactggtttgtgggcctcaagaagaacgggagctgtaagcgcggtcctcggactcactat
ggccagaaagccatcttgtttctgcccctcccggtgtcttctgactag

KEGG   Mus musculus (mouse): 14165
Entry
14165             CDS       T01002                                 

Gene name
Fgf10, AEY1, AEY17, BB213776, Fgf-10, Gsfaey, Gsfaey17
Definition
(RefSeq) fibroblast growth factor 10
  KO
K04358  fibroblast growth factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14165 (Fgf10)
   04014 Ras signaling pathway
    14165 (Fgf10)
   04015 Rap1 signaling pathway
    14165 (Fgf10)
   04020 Calcium signaling pathway
    14165 (Fgf10)
   04151 PI3K-Akt signaling pathway
    14165 (Fgf10)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14165 (Fgf10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14165 (Fgf10)
  09162 Cancer: specific types
   05226 Gastric cancer
    14165 (Fgf10)
   05218 Melanoma
    14165 (Fgf10)
   05224 Breast cancer
    14165 (Fgf10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    14165 (Fgf10)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    14165 (Fgf10)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   14165 (Fgf10)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   14165 (Fgf10)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 14165
NCBI-ProteinID: NP_032028
MGI: 1099809
Ensembl: ENSMUSG00000021732
Vega: OTTMUSG00000032890
UniProt: O35565
Position
13 D2.3; 13 67.14 cM
AA seq 209 aa
MWKWILTHCASAFPHLPGCCCCFLLLFLVSSFPVTCQALGQDMVSQEATNCSSSSSSFSS
PSSAGRHVRSYNHLQGDVRWRRLFSFTKYFLTIEKNGKVSGTKNEDCPYSVLEITSVEIG
VVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVA
LNGKGAPRRGQKTRRKNTSAHFLPMTIQT
NT seq 630 nt   +upstreamnt  +downstreamnt
atgtggaaatggatactgacacattgtgcctcagcctttccccacctgccgggctgctgt
tgctgcttcttgttgctctttttggtgtcttcgttccctgtcacctgccaagctcttggt
caggacatggtgtcacaggaggccaccaactgctcttcttcctcctcgtccttctcctct
ccttccagtgcgggaaggcatgtgcggagctacaatcacctccaaggagatgtccgctgg
agaaggctgttctccttcaccaagtactttctcacgattgagaagaacggcaaggtcagc
gggaccaagaatgaagactgtccgtacagtgtcctggagataacatcagtggaaatcgga
gttgttgccgtcaaagccatcaacagcaactattacttagccatgaacaagaaggggaaa
ctctatggctcaaaagagtttaacaacgactgtaagctgaaagagagaatagaggaaaat
ggatacaacacctatgcatcttttaactggcagcacaatggcaggcaaatgtatgtggca
ttgaatggaaaaggagctcccaggagaggacaaaaaacaagaaggaaaaacacctctgct
cacttcctccccatgacgatccaaacatag

KEGG   Mus musculus (mouse): 14170
Entry
14170             CDS       T01002                                 

Gene name
Fgf15, FGF19
Definition
(RefSeq) fibroblast growth factor 15
  KO
K22603  fibroblast growth factor 19
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14170 (Fgf15)
   04014 Ras signaling pathway
    14170 (Fgf15)
   04015 Rap1 signaling pathway
    14170 (Fgf15)
   04020 Calcium signaling pathway
    14170 (Fgf15)
   04151 PI3K-Akt signaling pathway
    14170 (Fgf15)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14170 (Fgf15)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14170 (Fgf15)
  09162 Cancer: specific types
   05226 Gastric cancer
    14170 (Fgf15)
   05218 Melanoma
    14170 (Fgf15)
   05224 Breast cancer
    14170 (Fgf15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    14170 (Fgf15)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    14170 (Fgf15)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   14170 (Fgf15)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   14170 (Fgf15)
SSDB
Motif
Pfam: FGF Fascin DUF3458
Other DBs
NCBI-GeneID: 14170
NCBI-ProteinID: NP_032029
MGI: 1096383
Ensembl: ENSMUSG00000031073
Vega: OTTMUSG00000059889
UniProt: O35622 Q790L8
Position
7; 7 F5
AA seq 218 aa
MARKWNGRAVARALVLATLWLAVSGRPLAQQSQSVSDEDPLFLYGWGKITRLQYLYSAGP
YVSNCFLRIRSDGSVDCEEDQNERNLLEFRAVALKTIAIKDVSSVRYLCMSADGKIYGLI
RYSEEDCTFREEMDCLGYNQYRSMKHHLHIIFIQAKPREQLQDQKPSNFIPVFHRSFFET
GDQLRSKMFSLPLESDSMDPFRMVEDVDHLVKSPSFQK
NT seq 657 nt   +upstreamnt  +downstreamnt
atggcgagaaagtggaacgggcgtgcggtggcccgagccctggtcctggccactctgtgg
ctggctgtgtctgggcgtcccctggctcagcaatcccagtctgtgtcagatgaagatcca
ctctttctctacggctggggcaagattacccgcctgcagtacctgtactccgctggtccc
tatgtctccaactgcttcctccgaatccggagcgacggctctgtggactgcgaggaggac
caaaacgaacgaaatttgttggaattccgcgcggtcgctctgaagacgattgccatcaag
gacgtcagcagcgtgcggtacctctgcatgagcgcggacggcaagatatacgggctgatt
cgctactcggaggaagactgtaccttcagggaggaaatggactgtttaggctacaaccag
tacagatccatgaagcaccatctccatatcatcttcatccaggccaagcccagagaacag
ctccaggaccagaaaccctcaaactttatccccgtgtttcaccgctccttctttgaaacc
ggggaccagctgaggtctaaaatgttctccctgcccctggagagtgacagcatggatccg
ttcaggatggtggaggatgtagaccacctagtgaagagtcccagcttccagaaatga

KEGG   Mus musculus (mouse): 14171
Entry
14171             CDS       T01002                                 

Gene name
Fgf17
Definition
(RefSeq) fibroblast growth factor 17
  KO
K04358  fibroblast growth factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14171 (Fgf17)
   04014 Ras signaling pathway
    14171 (Fgf17)
   04015 Rap1 signaling pathway
    14171 (Fgf17)
   04020 Calcium signaling pathway
    14171 (Fgf17)
   04151 PI3K-Akt signaling pathway
    14171 (Fgf17)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14171 (Fgf17)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14171 (Fgf17)
  09162 Cancer: specific types
   05226 Gastric cancer
    14171 (Fgf17)
   05218 Melanoma
    14171 (Fgf17)
   05224 Breast cancer
    14171 (Fgf17)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    14171 (Fgf17)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    14171 (Fgf17)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   14171 (Fgf17)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   14171 (Fgf17)
SSDB
Motif
Pfam: FGF Fascin IL1
Other DBs
NCBI-GeneID: 14171
NCBI-ProteinID: NP_032030
MGI: 1202401
Ensembl: ENSMUSG00000022101
UniProt: P63075 Q0VF19
Position
14 D2; 14 36.4 cM
AA seq 216 aa
MGAARLLPNLTLCLQLLILCCQTQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSR
TSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKP
SGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQ
GQLPFPNHAERQKQFEFVGSAPTRRTKRTRRPQSQT
NT seq 651 nt   +upstreamnt  +downstreamnt
atgggagccgcccgcctgctgcctaaccttaccctgtgcttgcagctattgattctctgc
tgtcaaacacagggggagaatcacccgtctcctaattttaaccagtacgtgagggaccag
ggcgctatgaccgaccagctgagcaggcggcaaatccgtgaataccagctctacagccgg
accagtggcaagcacgtgcaggtcaccggacgtcgcatctctgccaccgcagaggatggc
aacaagttcgccaagctcatcgtggagacagatacattcggcagcagagtccgcatcaag
ggggcagagagcgagaagtacatctgtatgaacaagaggggcaagctgattgggaagccg
agcgggaagagcaaagactgcgtgttcaccgagatcgtactggagaacaactacacggcc
ttccagaacgcccggcacgagggctggttcatggctttcactcggcagggccggccacgc
caggcctcccggagccgccagaaccagcgagaggcccacttcatcaagcgcctctaccaa
ggccagctgccttttcccaaccacgctgaaaggcagaagcagttcgaatttgtgggctcc
gcccccactcgcaggaccaagcgcactcggaggccccagtcccaaacgtag

KEGG   Mus musculus (mouse): 14172
Entry
14172             CDS       T01002                                 

Gene name
Fgf18, D130055P09Rik, FGF-18
Definition
(RefSeq) fibroblast growth factor 18
  KO
K04358  fibroblast growth factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14172 (Fgf18)
   04014 Ras signaling pathway
    14172 (Fgf18)
   04015 Rap1 signaling pathway
    14172 (Fgf18)
   04020 Calcium signaling pathway
    14172 (Fgf18)
   04151 PI3K-Akt signaling pathway
    14172 (Fgf18)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14172 (Fgf18)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14172 (Fgf18)
  09162 Cancer: specific types
   05226 Gastric cancer
    14172 (Fgf18)
   05218 Melanoma
    14172 (Fgf18)
   05224 Breast cancer
    14172 (Fgf18)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    14172 (Fgf18)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    14172 (Fgf18)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   14172 (Fgf18)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   14172 (Fgf18)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 14172
NCBI-ProteinID: NP_032031
MGI: 1277980
Ensembl: ENSMUSG00000057967
Vega: OTTMUSG00000005390
UniProt: O89101
Position
11; 11 A4
AA seq 207 aa
MYSAPSACTCLCLHFLLLCFQVQVLAAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSR
TSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKP
DGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPK
GQAELQKPFKYTTVTKRSRRIRPTHPG
NT seq 624 nt   +upstreamnt  +downstreamnt
atgtattcagcgccctccgcctgcacttgcctgtgtttacactttctactgctgtgcttc
caggttcaggtgttggcagccgaggagaatgtggacttccgcatccacgtggagaaccag
acgcgggctcgagatgatgtgagtcggaagcagctgcgcttgtaccagctctatagcagg
accagtgggaagcacattcaagtcctgggccgtaggatcagtgcccgtggcgaggacggg
gacaagtatgcccagctcctagtggagacagataccttcgggagtcaagtccggatcaag
ggcaaggagacagaattctacctgtgtatgaaccgaaaaggcaagctcgtggggaagcct
gatggtactagcaaggagtgcgtgttcattgagaaggttctggaaaacaactacacggcc
ctgatgtctgccaagtactctggttggtatgtgggcttcaccaagaaggggcggcctcgc
aagggtcccaagacccgcgagaaccagcaagatgtacacttcatgaagcgttaccccaag
ggacaggccgagctgcagaagcccttcaaatacaccacagtcaccaagcgatcccggcgg
atccgccccactcaccccggctag

KEGG   Mus musculus (mouse): 14173
Entry
14173             CDS       T01002                                 

Gene name
Fgf2, Fgf-2, Fgfb, bFGF
Definition
(RefSeq) fibroblast growth factor 2
  KO
K18497  fibroblast growth factor 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04810  Regulation of actin cytoskeleton
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14173 (Fgf2)
   04014 Ras signaling pathway
    14173 (Fgf2)
   04015 Rap1 signaling pathway
    14173 (Fgf2)
   04020 Calcium signaling pathway
    14173 (Fgf2)
   04151 PI3K-Akt signaling pathway
    14173 (Fgf2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    14173 (Fgf2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14173 (Fgf2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14173 (Fgf2)
   05205 Proteoglycans in cancer
    14173 (Fgf2)
  09162 Cancer: specific types
   05226 Gastric cancer
    14173 (Fgf2)
   05218 Melanoma
    14173 (Fgf2)
   05224 Breast cancer
    14173 (Fgf2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    14173 (Fgf2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    14173 (Fgf2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    14173 (Fgf2)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    14173 (Fgf2)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   14173 (Fgf2)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   14173 (Fgf2)
SSDB
Motif
Pfam: FGF Fascin IL1
Other DBs
NCBI-GeneID: 14173
NCBI-ProteinID: NP_032032
MGI: 95516
Ensembl: ENSMUSG00000037225
Vega: OTTMUSG00000007393
UniProt: P15655 Q541T2
Position
3 B; 3 18.41 cM
AA seq 154 aa
MAASGITSLPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVK
LQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYS
SWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
NT seq 465 nt   +upstreamnt  +downstreamnt
atggctgccagcggcatcacctcgcttcccgcactgccggaggacggcggcgccgccttc
ccaccaggccacttcaaggaccccaagcggctctactgcaagaacggcggcttcttcctg
cgcatccatcccgacggccgcgtggatggcgtccgcgagaagagcgacccacacgtcaaa
ctacaactccaagcagaagagagaggagttgtgtctatcaagggagtgtgtgccaaccgg
taccttgctatgaaggaagatggacggctgctggcttctaagtgtgttacagaagagtgt
ttcttctttgaacgactggaatctaataactacaatacttaccggtcacggaaatactcc
agttggtatgtggcactgaaacgaactgggcagtataaactcggatccaaaacgggacct
ggacagaaggccatactgtttcttccaatgtctgctaagagctga

KEGG   Mus musculus (mouse): 14174
Entry
14174             CDS       T01002                                 

Gene name
Fgf3, Fgf-3, In, Int, Int-2, Int-P
Definition
(RefSeq) fibroblast growth factor 3
  KO
K04358  fibroblast growth factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14174 (Fgf3)
   04014 Ras signaling pathway
    14174 (Fgf3)
   04015 Rap1 signaling pathway
    14174 (Fgf3)
   04020 Calcium signaling pathway
    14174 (Fgf3)
   04151 PI3K-Akt signaling pathway
    14174 (Fgf3)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14174 (Fgf3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14174 (Fgf3)
  09162 Cancer: specific types
   05226 Gastric cancer
    14174 (Fgf3)
   05218 Melanoma
    14174 (Fgf3)
   05224 Breast cancer
    14174 (Fgf3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    14174 (Fgf3)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    14174 (Fgf3)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   14174 (Fgf3)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   14174 (Fgf3)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 14174
NCBI-ProteinID: NP_032033
MGI: 95517
Ensembl: ENSMUSG00000031074
Vega: OTTMUSG00000031027
UniProt: Q0VG15
Position
7 F5; 7 88.85 cM
AA seq 245 aa
MGLIWLLLLSLLEPSWPTTGPGTRLRRDAGGRGGVYEHLGGAPRRRKLYCATKYHLQLHP
SGRVNGSLENSAYSILEITAVEVGVVAIKGLFSGRYLAMNKRGRLYASDHYNAECEFVER
IHELGYNTYASRLYRTGSSGPGAQRQPGAQRPWYVSVNGKGRPRRGFKTRRTQKSSLFLP
RVLGHKDHEMVRLLQSSQPRAPGEGSQPRQRRQKKQSPSDHGKMETLSTRATPSTQLHTG
GLAVA
NT seq 738 nt   +upstreamnt  +downstreamnt
atgggcctgatctggcttctgctgctcagcttgctggaacccagctggccaactacgggg
cccgggacgcgactacgacgcgatgcgggcggccgtggtggcgtttacgagcacctcggc
ggggcgccacggcgccgcaagctctactgcgctaccaagtaccacctccagctgcaccca
agcggccgcgtgaacggcagccttgagaacagcgcctatagcatcctggagattactgcg
gtggaagtgggcgtggtggccatcaaagggctcttttctgggcggtacctggccatgaac
aagagaggacggctgtatgcttcggatcactacaacgcagagtgtgagtttgtggaacgg
atccatgagctgggctacaatacatatgcttcccgcctgtaccgcacagggtccagtggg
ccaggagctcaacggcaacctggtgcccagagaccttggtacgtgtcggtgaatggcaag
ggtcggccacgcaggggcttcaagacccgccgcacacaaaagtcctctctcttcctgccc
cgagtgctgggccacaaggaccatgagatggtgcggctgctgcagagtagccagccacga
gccccaggagagggcagccagcccaggcagcggaggcagaagaagcagagcccaagtgat
catggcaagatggagactttgtctaccagggccactccaagcacccagctgcatacaggt
ggactggctgtggcctga

KEGG   Mus musculus (mouse): 14175
Entry
14175             CDS       T01002                                 

Gene name
Fgf4, Fgf-4, Fgfk, HBGF-4, Hst1, Hstf-, Hstf-1, KS3, hst, hst-1, kFGF
Definition
(RefSeq) fibroblast growth factor 4
  KO
K04358  fibroblast growth factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14175 (Fgf4)
   04014 Ras signaling pathway
    14175 (Fgf4)
   04015 Rap1 signaling pathway
    14175 (Fgf4)
   04020 Calcium signaling pathway
    14175 (Fgf4)
   04151 PI3K-Akt signaling pathway
    14175 (Fgf4)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14175 (Fgf4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14175 (Fgf4)
  09162 Cancer: specific types
   05226 Gastric cancer
    14175 (Fgf4)
   05218 Melanoma
    14175 (Fgf4)
   05224 Breast cancer
    14175 (Fgf4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    14175 (Fgf4)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    14175 (Fgf4)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   14175 (Fgf4)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   14175 (Fgf4)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 14175
NCBI-ProteinID: NP_034332
MGI: 95518
Ensembl: ENSMUSG00000050917
Vega: OTTMUSG00000059887
UniProt: P11403
Position
7 F5; 7 88.88 cM
AA seq 202 aa
MAKRGPTTGTLLPRVLLALVVALADRGTAAPNGTRHAELGHGWDGLVARSLARLPVAAQP
PQAAVRSGAGDYLLGLKRLRRLYCNVGIGFHLQVLPDGRIGGVHADTRDSLLELSPVQRG
VVSIFGVASRFFVAMSSRGKLFGVPFFTDECKFKEILLPNNYNAYESYAYPGMFMALSKN
GRTKKGNRVSPTMKVTHFLPRL
NT seq 609 nt   +upstreamnt  +downstreamnt
atggcgaaacgcgggccgaccacagggacgctgctgcccagggtcctgctggccctggtg
gtggccctggcggaccgagggaccgccgcacccaacggcacgcggcacgcagaattgggg
cacggctgggacggcttggtggcccgctcgctggcacgcctgccggtggccgcgcagccc
ccgcaggcggcggtccgcagcggcgcaggggactacctgctgggcctcaaaaggcttcgg
cggctctactgcaacgtgggcatcggattccacctgcaggtgctgcccgacggccgcatc
ggtggtgtgcacgcagacacgagggacagtcttctggagctctctccggtgcagcgaggc
gtggtgagcatcttcggagtggccagccggttcttcgtggccatgagcagcaggggcaag
ctcttcggtgtgcctttctttaccgacgagtgtaaattcaaagaaatacttctgcccaac
aactacaacgcctacgaatcctacgcgtaccccggtatgttcatggccctcagtaagaac
gggcggaccaagaaggggaaccgagtgtcgcctaccatgaaggtaacccacttccttcct
agactgtga

KEGG   Mus musculus (mouse): 14176
Entry
14176             CDS       T01002                                 

Gene name
Fgf5, Fgf-5, HBGF-5, angora, go
Definition
(RefSeq) fibroblast growth factor 5
  KO
K04358  fibroblast growth factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14176 (Fgf5)
   04014 Ras signaling pathway
    14176 (Fgf5)
   04015 Rap1 signaling pathway
    14176 (Fgf5)
   04020 Calcium signaling pathway
    14176 (Fgf5)
   04151 PI3K-Akt signaling pathway
    14176 (Fgf5)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14176 (Fgf5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14176 (Fgf5)
  09162 Cancer: specific types
   05226 Gastric cancer
    14176 (Fgf5)
   05218 Melanoma
    14176 (Fgf5)
   05224 Breast cancer
    14176 (Fgf5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    14176 (Fgf5)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    14176 (Fgf5)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   14176 (Fgf5)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   14176 (Fgf5)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 14176
NCBI-ProteinID: NP_034333
MGI: 95519
Ensembl: ENSMUSG00000029337
Vega: OTTMUSG00000053547
UniProt: P15656
Position
5 E3; 5 47.77 cM
AA seq 264 aa
MSLSLLFLIFCSHLIHSAWAHGEKRLTPEGQPAPPRNPGDSSGSRGRSSATFSSSSASSP
VAASPGSQGSGSEHSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEASVLSILE
IFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTE
KTGREWYVALNKRGKAKRGCSPRVKPQHVSTHFLPRFKQSEQPELSFTVTVPEKKKPPVK
PKVPLSQPRRSPSPVKYRLKFRFG
NT seq 795 nt   +upstreamnt  +downstreamnt
atgagcctgtccttgctcttcctcatcttctgcagccacctgatccacagcgcttgggct
cacggggagaagcgtctcactcccgaagggcaacccgcgcctcctaggaacccgggagac
tccagcggcagccggggcagaagtagcgcgacgttttcttcgtcttctgcctcctcacca
gtcgcagcttctccgggcagccaaggaagcggctcggaacatagcagtttccagtggagc
ccttcggggcgccggaccggcagcctgtactgcagagtgggcatcggtttccatctgcag
atctacccggatggcaaagtcaatggctcccacgaagccagtgtgttaagtattttggaa
atatttgctgtgtctcaggggattgtaggaatacgaggagttttcagcaacaaattttta
gcgatgtcaaaaaaaggaaaactccatgcaagtgccaaatttacggatgactgtaagttc
agggagagattccaagaaaacagctataatacctatgcgtccgcgatccacagaactgaa
aagacaggccgagagtggtacgtggccctgaacaagagagggaaagccaagagaggctgc
agcccacgggtcaaaccccaacacgtctccacccacttcctacccaggttcaagcagtcc
gagcaaccggaactttccttcaccgtcactgttccagaaaagaaaaagccaccggtgaaa
ccaaaggtgcccctgtcgcagcctcgcagaagtcccagcccagtgaagtacagactgaag
tttcgctttggatga

KEGG   Mus musculus (mouse): 14177
Entry
14177             CDS       T01002                                 

Gene name
Fgf6, Fgf-6, HSTF-2
Definition
(RefSeq) fibroblast growth factor 6
  KO
K04358  fibroblast growth factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14177 (Fgf6)
   04014 Ras signaling pathway
    14177 (Fgf6)
   04015 Rap1 signaling pathway
    14177 (Fgf6)
   04020 Calcium signaling pathway
    14177 (Fgf6)
   04151 PI3K-Akt signaling pathway
    14177 (Fgf6)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14177 (Fgf6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14177 (Fgf6)
  09162 Cancer: specific types
   05226 Gastric cancer
    14177 (Fgf6)
   05218 Melanoma
    14177 (Fgf6)
   05224 Breast cancer
    14177 (Fgf6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    14177 (Fgf6)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    14177 (Fgf6)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   14177 (Fgf6)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   14177 (Fgf6)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 14177
NCBI-ProteinID: NP_034334
MGI: 95520
Ensembl: ENSMUSG00000000183
Vega: OTTMUSG00000056342
UniProt: P21658 Q8C399
Position
6 F3; 6 61.92 cM
AA seq 208 aa
MALGQRLFITMSRGAGRVQGTLQALVFLGVLVGMVVPSPAGARANGTLLDSRGWGTLLSR
SRAGLAGEISGVNWESGYLVGIKRQRRLYCNVGIGFHLQVPPDGRISGTHEENPYSLLEI
STVERGVVSLFGVKSALFIAMNSKGRLYTTPSFHDECKFRETLLPNNYNAYESDLYRGTY
IALSKYGRVKRGSKVSPIMTVTHFLPRI
NT seq 627 nt   +upstreamnt  +downstreamnt
atggccctgggacagaggctgttcatcactatgtcccggggagcaggacgtgttcagggc
acgctgcaggctctcgtcttcttaggcgtcctagtgggcatggtggtgccctcacctgcc
ggcgcccgcgccaacggcacgctactggactccagaggctggggcaccctcttgtccagg
tctcgagctgggctagctggagagatttcgggtgtgaattgggaaagcggctatttggtg
ggcattaagcgacagcggagactctactgcaacgtgggcattggcttccacctccaggtg
cctcctgacggccgcatcagtggaacacacgaggagaacccctacagcctgctggagatc
tccacggtagaacggggtgtggtgagcctcttcggggtgaagagtgctctcttcattgcc
atgaacagtaaaggaagactgtacacaacgcccagcttccacgacgaatgcaagttccga
gaaaccctccttccaaacaactacaacgcctacgagtcagacctgtacagagggacctac
attgcactgagcaaatatggacgggtaaagcggggcagcaaggtgtccccaatcatgact
gtcactcacttcctccccaggatataa

KEGG   Mus musculus (mouse): 14178
Entry
14178             CDS       T01002                                 

Gene name
Fgf7, Kgf
Definition
(RefSeq) fibroblast growth factor 7
  KO
K04358  fibroblast growth factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14178 (Fgf7)
   04014 Ras signaling pathway
    14178 (Fgf7)
   04015 Rap1 signaling pathway
    14178 (Fgf7)
   04020 Calcium signaling pathway
    14178 (Fgf7)
   04151 PI3K-Akt signaling pathway
    14178 (Fgf7)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14178 (Fgf7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14178 (Fgf7)
  09162 Cancer: specific types
   05226 Gastric cancer
    14178 (Fgf7)
   05218 Melanoma
    14178 (Fgf7)
   05224 Breast cancer
    14178 (Fgf7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    14178 (Fgf7)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    14178 (Fgf7)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   14178 (Fgf7)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   14178 (Fgf7)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 14178
NCBI-ProteinID: NP_032034
MGI: 95521
Ensembl: ENSMUSG00000027208
Vega: OTTMUSG00000015341
UniProt: P36363 Q544I6
Position
2; 2 F1
AA seq 194 aa
MRKWILTRILPTLLYRSCFHLVCLVGTISLACNDMSPEQTATSVNCSSPERHTRSYDYME
GGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNSYNIMEIRTVAVGIVAIKGVESEYYLA
MNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHSGGEMFVALNQKGIPVKGKKTK
KEQKTAHFLPMAIT
NT seq 585 nt   +upstreamnt  +downstreamnt
atgcgcaaatggatactgacacggatcctgccaactctgctctacagatcatgcttccac
ctcgtctgtctagtgggcactatatctctagcttgcaatgacatgagtccggagcaaacg
gctacgagtgtgaactgttccagccccgagcgacacaccagaagttatgactacatggaa
ggaggggatataagggtgagaagactgttctgtcgcacccagtggtacctgaggattgac
aaacgaggcaaagtgaaagggacccaggagatgaagaacagctacaacatcatggaaatc
aggaccgtggcagttggaattgtggcaatcaaaggggtggaaagtgaatactatcttgcc
atgaacaaggaagggaaactctatgcaaagaaagaatgcaatgaggattgcaacttcaaa
gaactgattctggaaaaccattataacacctatgcatcagctaaatggacacacagcgga
ggggaaatgttcgttgccttaaatcaaaaggggattcctgtcaaagggaagaaaacgaag
aaagaacaaaaaacagcccattttcttcctatggcaataacctaa

KEGG   Mus musculus (mouse): 14179
Entry
14179             CDS       T01002                                 

Gene name
Fgf8, Ai, Aigf, Fgf-8
Definition
(RefSeq) fibroblast growth factor 8
  KO
K04358  fibroblast growth factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14179 (Fgf8)
   04014 Ras signaling pathway
    14179 (Fgf8)
   04015 Rap1 signaling pathway
    14179 (Fgf8)
   04020 Calcium signaling pathway
    14179 (Fgf8)
   04151 PI3K-Akt signaling pathway
    14179 (Fgf8)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14179 (Fgf8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14179 (Fgf8)
  09162 Cancer: specific types
   05226 Gastric cancer
    14179 (Fgf8)
   05218 Melanoma
    14179 (Fgf8)
   05224 Breast cancer
    14179 (Fgf8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    14179 (Fgf8)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    14179 (Fgf8)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   14179 (Fgf8)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   14179 (Fgf8)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 14179
NCBI-ProteinID: NP_034335
MGI: 99604
Ensembl: ENSMUSG00000025219
Vega: OTTMUSG00000021697
UniProt: P37237 Q80ZL6
Position
19 C3; 19 38.75 cM
AA seq 268 aa
MGSPRSALSCLLLHLLVLCLQAQVRSAAQKRGPGAGNPADTLGQGHEDRPFGQRSRAGKN
FTNPAPNYPEEGSKEQRDSVLPKVTQRHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQV
LANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDC
VFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQ
SLRFEFLNYPPFTRSLRGSQRTWAPEPR
NT seq 807 nt   +upstreamnt  +downstreamnt
atgggcagcccccgctccgcgctgagctgcctgctgttgcacttgctggttctctgcctc
caagcccaggtaaggagcgctgcgcagaagcgggggccgggcgcggggaacccagctgac
actctcgggcagggacacgaggaccgacccttcggccagcgcagcagggctggaaagaac
tttacaaatccagccccaaactaccccgaggagggatctaaggaacagagagacagtgtc
ctgcctaaagtcacacagcgacatgtgagggagcagagcctggtgacggatcagctcagc
cgccgcctcatccggacctaccagctctacagccgcaccagcgggaagcacgtgcaggtc
ctggccaacaagcgcatcaacgccatggcagaagacggagaccccttcgcgaagctcatt
gtggagaccgatacttttggaagcagagtccgagttcgcggcgcagagacaggtctctac
atctgcatgaacaagaaggggaagctaattgccaagagcaacggcaaaggcaaggactgc
gtattcacagagatcgtgctggagaacaactacacggcgctgcagaacgccaagtacgag
ggctggtacatggcctttacccgcaagggccggccccgcaagggctccaagacgcgccag
catcagcgcgaggtgcacttcatgaagcgcctgccgcggggccaccacaccaccgagcag
agcctgcgcttcgagttcctcaactacccgcccttcacgcgcagcctgcgcggcagccag
aggacttgggccccggagccccgatag

KEGG   Mus musculus (mouse): 14180
Entry
14180             CDS       T01002                                 

Gene name
Fgf9, Ek, Eks
Definition
(RefSeq) fibroblast growth factor 9
  KO
K04358  fibroblast growth factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14180 (Fgf9)
   04014 Ras signaling pathway
    14180 (Fgf9)
   04015 Rap1 signaling pathway
    14180 (Fgf9)
   04020 Calcium signaling pathway
    14180 (Fgf9)
   04151 PI3K-Akt signaling pathway
    14180 (Fgf9)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14180 (Fgf9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14180 (Fgf9)
  09162 Cancer: specific types
   05226 Gastric cancer
    14180 (Fgf9)
   05218 Melanoma
    14180 (Fgf9)
   05224 Breast cancer
    14180 (Fgf9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    14180 (Fgf9)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    14180 (Fgf9)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   14180 (Fgf9)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   14180 (Fgf9)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 14180
NCBI-ProteinID: NP_038546
MGI: 104723
Ensembl: ENSMUSG00000021974
Vega: OTTMUSG00000036883
UniProt: P54130
Position
14 C3; 14 30.51 cM
AA seq 208 aa
MAPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGI
LRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNE
KGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKR
HQKFTHFLPRPVDPDKVPELYKDILSQS
NT seq 627 nt   +upstreamnt  +downstreamnt
atggctcccttaggtgaagttgggagctatttcggtgtgcaggacgcggtaccgttcggg
aacgtaccggtgttgccggtggacagtccggtgttgctaagtgaccacctgggtcagtcc
gaagcaggggggctgccccggggccccgcagtcacggacttggatcatttaaaggggatt
ctcaggcggaggcagctgtactgcaggactggatttcatttagagatcttccccaacggt
actatccagggaaccaggaaagaccacagccgcttcggcattctggaatttatcagtata
gcagtgggcctggtcagcattcgcggtgtggacagtggactctacctcggcatgaacgag
aagggggagctgtatggatcagaaaaactaacacaggaatgtgtgttcagagaacagttt
gaagagaactggtacaacacctactcttccaacctctataaacatgtggacaccggaagg
agatactatgttgcattaaataaggacgggactccaagagaagggaccaggactaaacgg
caccagaaatttacacattttttacctagaccagtggaccctgacaaagtacctgaacta
tataaggatattctaagccaaagctga

KEGG   Mus musculus (mouse): 14205
Entry
14205             CDS       T01002                                 

Gene name
Vegfd, AI325264, Fig, Figf, VEGF-, VEGF-D
Definition
(RefSeq) vascular endothelial growth factor D
  KO
K05449  vascular endothelial growth factor C/D
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04668  TNF signaling pathway
mmu04926  Relaxin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14205 (Vegfd)
   04014 Ras signaling pathway
    14205 (Vegfd)
   04015 Rap1 signaling pathway
    14205 (Vegfd)
   04668 TNF signaling pathway
    14205 (Vegfd)
   04020 Calcium signaling pathway
    14205 (Vegfd)
   04151 PI3K-Akt signaling pathway
    14205 (Vegfd)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    14205 (Vegfd)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    14205 (Vegfd)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14205 (Vegfd)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    14205 (Vegfd)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    14205 (Vegfd)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   14205 (Vegfd)
SSDB
Motif
Pfam: PDGF CXCXC
Other DBs
NCBI-GeneID: 14205
NCBI-ProteinID: NP_034346
MGI: 108037
Ensembl: ENSMUSG00000031380
Vega: OTTMUSG00000019516
UniProt: P97946
Position
X F5; X 76.35 cM
AA seq 358 aa
MYGEWGMGNILMMFHVYLVQGFRSEHGPVKDFSFERSSRSMLERSEQQIRAASSLEELLQ
IAHSEDWKLWRCRLKLKSLASMDSRSASHRSTRFAATFYDTETLKVIDEEWQRTQCSPRE
TCVEVASELGKTTNTFFKPPCVNVFRCGGCCNEEGVMCMNTSTSYISKQLFEISVPLTSV
PELVPVKIANHTGCKCLPTGPRHPYSIIRRSIQTPEEDECPHSKKLCPIDMLWDNTKCKC
VLQDETPLPGTEDHSYLQEPTLCGPHMTFDEDRCECVCKAPCPGDLIQHPENCSCFECKE
SLESCCQKHKIFHPDTCSCEDRCPFHTRTCASRKPACGKHWRFPKETRAQGLYSQENP
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgtatggagaatggggaatggggaatatcctcatgatgttccatgtgtacttggtgcag
ggcttcaggagcgaacatggaccagtgaaggatttttcttttgagcgatcatcccggtcc
atgttggaacgatctgaacaacagatccgagcagcttctagtttggaggagttgctgcaa
atcgcgcactctgaggactggaagctgtggcgatgccggttgaagctcaaaagtcttgcc
agtatggactcacgctcagcatcccatcgctccaccagatttgcggcaactttctatgac
actgaaacactaaaagttatagatgaagaatggcagaggacccaatgcagccctagagag
acatgcgtagaagtcgccagtgagctggggaagacaaccaacacattcttcaagcccccc
tgtgtaaatgtcttccggtgtggaggctgctgcaacgaagagggtgtgatgtgtatgaac
acaagcacctcctacatctccaaacagctctttgagatatcagtgcctctgacatcagtg
cccgagttagtgcctgttaaaattgccaaccatacgggttgtaagtgcttgcccacgggc
ccccgccatccttactcaattatcagaagatccattcagaccccagaagaagatgaatgt
cctcattccaagaaactctgtcctattgacatgctgtgggataacaccaaatgtaaatgt
gttttgcaagacgagactccactgcctgggacagaagaccactcttacctccaggaaccc
actctctgtggaccgcacatgacgtttgatgaagatcgctgtgagtgcgtctgtaaagca
ccatgtccgggagatctcattcagcacccggaaaactgcagttgctttgagtgcaaagaa
agtctggagagctgctgccaaaagcacaagatttttcacccagacacctgcagctgtgag
gacagatgtccttttcacaccagaacatgtgcaagtagaaagccagcctgtggaaagcac
tggcgctttccaaaggagacaagggcccagggactctacagccaggagaacccttga

KEGG   Mus musculus (mouse): 14256
Entry
14256             CDS       T01002                                 

Gene name
Flt3l, Flt3lg, Ly72L
Definition
(RefSeq) FMS-like tyrosine kinase 3 ligand
  KO
K05454  fms-related tyrosine kinase 3 ligand
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04640  Hematopoietic cell lineage
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14256 (Flt3l)
   04014 Ras signaling pathway
    14256 (Flt3l)
   04151 PI3K-Akt signaling pathway
    14256 (Flt3l)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    14256 (Flt3l)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14256 (Flt3l)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    14256 (Flt3l)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   14256 (Flt3l)
SSDB
Motif
Pfam: Flt3_lig
Other DBs
NCBI-GeneID: 14256
NCBI-ProteinID: NP_038548
MGI: 95560
Ensembl: ENSMUSG00000110206
Vega: OTTMUSG00000033411
UniProt: P49772 A9QW46
Position
7 B3; 7 29.14 cM
AA seq 232 aa
MTVLAPAWSPNSSLLLLLLLLSPCLRGTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVT
VAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPEC
LRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEAT
ELPEPRPRQLLLLLLLLLPLTLVLLAAAWGLRWQRARRRGELHPGVPLPSHP
NT seq 699 nt   +upstreamnt  +downstreamnt
atgacagtgctggcgccagcctggagcccaaattcctccctgttgctgctgttgctgctg
ctgagtccttgcctgcgggggacacctgactgttacttcagccacagtcccatctcctcc
aacttcaaagtgaagtttagagagttgactgaccacctgcttaaagattacccagtcact
gtggccgtcaatcttcaggacgagaagcactgcaaggccttgtggagcctcttcctagcc
cagcgctggatagagcaactgaagactgtggcagggtctaagatgcaaacgcttctggag
gacgtcaacaccgagatacattttgtcacctcatgtaccttccagcccctaccagaatgt
ctgcgattcgtccagaccaacatctcccacctcctgaaggacacctgcacacagctgctt
gctctgaagccctgtatcgggaaggcctgccagaatttctctcggtgcctggaggtgcag
tgccagccggactcctccaccctgctgcccccaaggagtcccatagccctagaagccacg
gagctcccagagcctcggcccaggcagctgttgctcctgctgctgctgctgctgcctctc
acactggtgctgctggcagccgcctggggccttcgctggcaaagggcaagaaggaggggg
gagctccaccctggggtgcccctcccctcccatccctag

KEGG   Mus musculus (mouse): 15234
Entry
15234             CDS       T01002                                 

Gene name
Hgf, C230052L06Rik, HGF/S, HGF/SF, NK, NK1, NK2, SF, SF/HG, SF/HGF
Definition
(RefSeq) hepatocyte growth factor
  KO
K05460  hepatocyte growth factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu05144  Malaria
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05211  Renal cell carcinoma
mmu05218  Melanoma
mmu05223  Non-small cell lung cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    15234 (Hgf)
   04014 Ras signaling pathway
    15234 (Hgf)
   04015 Rap1 signaling pathway
    15234 (Hgf)
   04020 Calcium signaling pathway
    15234 (Hgf)
   04151 PI3K-Akt signaling pathway
    15234 (Hgf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    15234 (Hgf)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    15234 (Hgf)
   05205 Proteoglycans in cancer
    15234 (Hgf)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    15234 (Hgf)
   05226 Gastric cancer
    15234 (Hgf)
   05218 Melanoma
    15234 (Hgf)
   05211 Renal cell carcinoma
    15234 (Hgf)
   05223 Non-small cell lung cancer
    15234 (Hgf)
  09174 Infectious disease: parasitic
   05144 Malaria
    15234 (Hgf)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    15234 (Hgf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    15234 (Hgf)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    15234 (Hgf)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   15234 (Hgf)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   15234 (Hgf)
SSDB
Motif
Pfam: Kringle Trypsin PAN_1 DUF1986 DUF316
Other DBs
NCBI-GeneID: 15234
NCBI-ProteinID: NP_001276387
MGI: 96079
Ensembl: ENSMUSG00000028864
Vega: OTTMUSG00000055308
UniProt: Q08048 Q8C9G5
Structure
PDB: 
3HMR 2QJ4 4IUA

Position
5 A3; 5 7.07 cM
AA seq 728 aa
MMWGTKLLPVLLLQHVLLHLLLLHVAIPYAEGQKKRRNTLHEFKKSAKTTLTKEDPLLKI
KTKKVNSADECANRCIRNRGFTFTCKAFVFDKSRKRCYWYPFNSMSSGVKKGFGHEFDLY
ENKDYIRNCIIGKGGSYKGTVSITKSGIKCQPWNSMIPHEHSFLPSSYRGKDLQENYCRN
PRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGPMDHTESGKTCQRWDQQT
PHRHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKTCAHSAVNETDVP
METTECIQGQGEGYRGTSNTIWNGIPCQRWDSQYPHKHDITPENFKCKDLRENYCRNPDG
AESPWCFTTDPNIRVGYCSQIPKCDVSSGQDCYRGNGKNYMGNLSKTRSGLTCSMWDKNM
EDLHRHIFWEPDASKLNKNYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVN
LDHPVISCAKTKQLRVVNGIPTQTTVGWMVSLKYRNKHICGGSLIKESWVLTARQCFPAR
NKDLKDYEAWLGIHDVHERGEEKRKQILNISQLVYGPEGSDLVLLKLARPAILDNFVSTI
DLPSYGCTIPEKTTCSIYGWGYTGLINADGLLRVAHLYIMGNEKCSQHHQGKVTLNESEL
CAGAEKIGSGPCEGDYGGPLICEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIH
KVILTYKL
NT seq 2187 nt   +upstreamnt  +downstreamnt
atgatgtgggggaccaaacttctgccggtcctgttgctgcagcatgtcctcctgcacctc
ctcctgcttcatgtcgccatcccctatgcagaaggacagaagaaaagaagaaatacactt
catgaatttaaaaagtcagcaaaaactactcttaccaaggaagacccattactgaagatt
aaaaccaaaaaagtgaactctgcagatgagtgtgccaacaggtgtatcaggaacaggggc
tttacgttcacttgcaaggccttcgtttttgataagtcaagaaaacgatgctactggtat
cctttcaatagtatgtcaagtggagtgaaaaaagggtttggccatgaatttgacctctat
gaaaacaaagactatattagaaactgcatcattggtaaaggaggcagctataaagggacg
gtatccatcactaagagtggcatcaaatgccagccttggaattccatgatcccccatgaa
cacagctttttgccttcgagctatcgcggtaaagacctacaggaaaactactgtcgaaat
cctcgaggggaagaagggggaccctggtgtttcacaagcaatccagaggtacgctacgaa
gtctgtgacattcctcagtgttcagaagttgaatgcatgacctgcaatggtgaaagctac
agaggtcccatggatcacacagaatcaggcaagacttgtcagcgctgggaccagcagaca
ccacaccggcacaagttcttgccagaaagatatcccgacaagggctttgatgataattat
tgccgcaatcctgatggcaagccgaggccatggtgctacactcttgaccctgacacccct
tgggagtattgtgcaattaaaacgtgcgctcacagtgctgtgaatgagactgatgtccct
atggaaacaactgaatgcattcaaggccaaggagaaggttacaggggaaccagcaatacc
atttggaatggaattccctgtcagcgttgggattcgcagtaccctcacaagcatgatatc
actcccgagaacttcaaatgcaaggaccttagagaaaattattgccgcaatccagatggg
gctgaatcaccatggtgttttaccactgacccaaacatccgagttggctactgctctcaa
attcccaagtgtgacgtgtcaagtggacaagattgttatcgtggcaatgggaaaaattac
atgggcaacttatccaaaacaaggtctggacttacatgttccatgtgggacaagaatatg
gaggatttacaccgtcatatcttctgggagccagatgctagcaaattgaataagaattac
tgccggaatcctgatgatgatgcccatggaccttggtgctacacggggaatcctcttatt
ccttgggattattgccctatttcccgttgtgaaggagatactacacctacaattgtcaat
ttggaccatcctgtaatatcctgtgccaaaacaaaacaactgcgggttgtaaatggcatt
ccaacacaaacaacagtagggtggatggttagtttgaaatacagaaataaacatatctgt
ggaggatcattgataaaggaaagttgggttcttactgcaagacaatgttttccagccaga
aacaaagacttgaaagactatgaagcttggcttggcatccacgatgttcatgagagaggc
gaggagaagcgcaagcagatcttaaacatttcccagctggtctatggtcctgaaggctca
gacttggttttactgaagcttgctcgacctgcaatcctggataactttgtcagtacaatt
gatttacctagttatggttgtacaatccctgaaaagaccacttgcagtatttacggctgg
ggctacactggattgatcaacgcggatggtttattacgagtagctcatctgtatattatg
gggaatgagaaatgcagtcagcaccatcaaggcaaggtgactttgaatgagtctgagtta
tgtgctggggctgaaaagattggatcaggaccatgtgagggagattatggtggcccactc
atttgtgaacaacacaaaatgagaatggttcttggtgtcattgttcctggtcgtggatgt
gccatcccaaatcgtcctggtatttttgttcgagtagcatattatgcaaaatggatacac
aaagtaattttgacatacaagttgtaa

KEGG   Mus musculus (mouse): 16000
Entry
16000             CDS       T01002                                 

Gene name
Igf1, C730016P09Rik, Igf, Igf-, Igf-1, Igf-I
Definition
(RefSeq) insulin-like growth factor 1
  KO
K05459  insulin-like growth factor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu01522  Endocrine resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04114  Oocyte meiosis
mmu04115  p53 signaling pathway
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04510  Focal adhesion
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04730  Long-term depression
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04913  Ovarian steroidogenesis
mmu04914  Progesterone-mediated oocyte maturation
mmu04935  Growth hormone synthesis, secretion and action
mmu04960  Aldosterone-regulated sodium reabsorption
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05205  Proteoglycans in cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05410  Hypertrophic cardiomyopathy
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    16000 (Igf1)
   04014 Ras signaling pathway
    16000 (Igf1)
   04015 Rap1 signaling pathway
    16000 (Igf1)
   04066 HIF-1 signaling pathway
    16000 (Igf1)
   04068 FoxO signaling pathway
    16000 (Igf1)
   04151 PI3K-Akt signaling pathway
    16000 (Igf1)
   04152 AMPK signaling pathway
    16000 (Igf1)
   04150 mTOR signaling pathway
    16000 (Igf1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    16000 (Igf1)
   04115 p53 signaling pathway
    16000 (Igf1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16000 (Igf1)
   04550 Signaling pathways regulating pluripotency of stem cells
    16000 (Igf1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    16000 (Igf1)
   04914 Progesterone-mediated oocyte maturation
    16000 (Igf1)
   04935 Growth hormone synthesis, secretion and action
    16000 (Igf1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    16000 (Igf1)
  09156 Nervous system
   04730 Long-term depression
    16000 (Igf1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    16000 (Igf1)
  09149 Aging
   04211 Longevity regulating pathway
    16000 (Igf1)
   04213 Longevity regulating pathway - multiple species
    16000 (Igf1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16000 (Igf1)
   05202 Transcriptional misregulation in cancer
    16000 (Igf1)
   05205 Proteoglycans in cancer
    16000 (Igf1)
  09162 Cancer: specific types
   05214 Glioma
    16000 (Igf1)
   05218 Melanoma
    16000 (Igf1)
   05215 Prostate cancer
    16000 (Igf1)
   05224 Breast cancer
    16000 (Igf1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    16000 (Igf1)
   05414 Dilated cardiomyopathy
    16000 (Igf1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    16000 (Igf1)
   01522 Endocrine resistance
    16000 (Igf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    16000 (Igf1)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   16000 (Igf1)
SSDB
Motif
Pfam: Insulin
Other DBs
NCBI-GeneID: 16000
NCBI-ProteinID: NP_001104745
MGI: 96432
Ensembl: ENSMUSG00000020053
Vega: OTTMUSG00000031391
UniProt: P05017 Q4VJC0
Position
10 C1; 10 43.7 cM
AA seq 153 aa
MGKISSLPTQLFKICLCDFLKIKIHIMSSSHLFYLALCLLTFTSSTTAGPETLCGAELVD
ALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAARS
IRAQRHTDMPKTQKEVHLKNTSRGSAGNKTYRM
NT seq 462 nt   +upstreamnt  +downstreamnt
atggggaaaatcagcagccttccaactcaattatttaagatctgcctctgtgacttcttg
aagataaagatacacatcatgtcgtcttcacacctcttctacctggcgctctgcttgctc
accttcaccagctccaccacagctggaccagagaccctttgcggggctgagctggtggat
gctcttcagttcgtgtgtggaccgaggggcttttacttcaacaagcccacaggctatggc
tccagcattcggagggcacctcagacaggcattgtggatgagtgttgcttccggagctgt
gatctgaggagactggagatgtactgtgccccactgaagcctacaaaagcagcccgctct
atccgtgcccagcgccacactgacatgcccaagactcagaaggaagtacatttgaagaac
acaagtagaggaagtgcaggaaacaagacctacagaatgtag

KEGG   Mus musculus (mouse): 16002
Entry
16002             CDS       T01002                                 

Gene name
Igf2, AL033362, Igf, Igf-, Igf-2, Igf-II, M, M6, M6pr, Mpr, Peg, Peg2
Definition
(RefSeq) insulin-like growth factor 2
  KO
K13769  insulin-like growth factor 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    16002 (Igf2)
   04014 Ras signaling pathway
    16002 (Igf2)
   04151 PI3K-Akt signaling pathway
    16002 (Igf2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16002 (Igf2)
   05205 Proteoglycans in cancer
    16002 (Igf2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    16002 (Igf2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    16002 (Igf2)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    16002 (Igf2)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   16002 (Igf2)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   16002 (Igf2)
SSDB
Motif
Pfam: IGF2_C Insulin DUF1979
Other DBs
NCBI-GeneID: 16002
NCBI-ProteinID: NP_001116208
MGI: 96434
Ensembl: ENSMUSG00000048583
Vega: OTTMUSG00000035324
UniProt: P09535
Position
7 F5; 7 87.99 cM
AA seq 180 aa
MGIPVGKSMLVLLISLAFALCCIAAYGPGETLCGGELVDTLQFVCSDRGFYFSRPSSRAN
RRSRGIVEECCFRSCDLALLETYCATPAKSERDVSTSQAVLPDDFPRYPVGKFFQYDTWR
QSAGRLRRGLPALLRARRGRMLAKELKEFREAKRHRPLIVLPPKDPAHGGASSEMSSNHQ
NT seq 543 nt   +upstreamnt  +downstreamnt
atggggatcccagtggggaagtcgatgttggtgcttctcatctctttggccttcgccttg
tgctgcatcgctgcttacggccccggagagactctgtgcggaggggagcttgttgacacg
cttcagtttgtctgttcggaccgcggcttctacttcagcaggccttcaagccgtgccaac
cgtcgcagccgtggcatcgtggaagagtgctgcttccgcagctgcgacctggccctcctg
gagacatactgtgccacccccgccaagtccgagagggacgtgtctacctctcaggccgta
cttccggacgacttccccagataccccgtgggcaagttcttccaatatgacacctggaga
cagtccgcgggacgcctgcgcagaggcctgcctgccctcctgcgtgcccgccggggtcgc
atgcttgccaaagagctcaaagagttcagagaggccaaacgtcatcgtcccctgatcgtg
ttaccacccaaagaccccgcccacgggggagcctcttcggagatgtccagcaaccatcag
tga

KEGG   Mus musculus (mouse): 16333
Entry
16333             CDS       T01002                                 

Gene name
Ins1, Ins-1, Ins2-rs1
Definition
(RefSeq) insulin I
  KO
K04526  insulin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04114  Oocyte meiosis
mmu04140  Autophagy - animal
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04810  Regulation of actin cytoskeleton
mmu04910  Insulin signaling pathway
mmu04911  Insulin secretion
mmu04913  Ovarian steroidogenesis
mmu04914  Progesterone-mediated oocyte maturation
mmu04917  Prolactin signaling pathway
mmu04923  Regulation of lipolysis in adipocytes
mmu04930  Type II diabetes mellitus
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease
mmu04940  Type I diabetes mellitus
mmu04950  Maturity onset diabetes of the young
mmu04960  Aldosterone-regulated sodium reabsorption
mmu05010  Alzheimer disease
mmu05215  Prostate cancer
mmu05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    16333 (Ins1)
   04014 Ras signaling pathway
    16333 (Ins1)
   04015 Rap1 signaling pathway
    16333 (Ins1)
   04066 HIF-1 signaling pathway
    16333 (Ins1)
   04068 FoxO signaling pathway
    16333 (Ins1)
   04072 Phospholipase D signaling pathway
    16333 (Ins1)
   04022 cGMP-PKG signaling pathway
    16333 (Ins1)
   04151 PI3K-Akt signaling pathway
    16333 (Ins1)
   04152 AMPK signaling pathway
    16333 (Ins1)
   04150 mTOR signaling pathway
    16333 (Ins1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    16333 (Ins1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    16333 (Ins1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    16333 (Ins1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    16333 (Ins1)
   04910 Insulin signaling pathway
    16333 (Ins1)
   04923 Regulation of lipolysis in adipocytes
    16333 (Ins1)
   04913 Ovarian steroidogenesis
    16333 (Ins1)
   04914 Progesterone-mediated oocyte maturation
    16333 (Ins1)
   04917 Prolactin signaling pathway
    16333 (Ins1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    16333 (Ins1)
  09149 Aging
   04211 Longevity regulating pathway
    16333 (Ins1)
   04213 Longevity regulating pathway - multiple species
    16333 (Ins1)
 09160 Human Diseases
  09162 Cancer: specific types
   05215 Prostate cancer
    16333 (Ins1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    16333 (Ins1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    16333 (Ins1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    16333 (Ins1)
   04940 Type I diabetes mellitus
    16333 (Ins1)
   04950 Maturity onset diabetes of the young
    16333 (Ins1)
   04932 Non-alcoholic fatty liver disease
    16333 (Ins1)
   04931 Insulin resistance
    16333 (Ins1)
SSDB
Motif
Pfam: Insulin Ins_beta
Other DBs
NCBI-GeneID: 16333
NCBI-ProteinID: NP_032412
MGI: 96572
Ensembl: ENSMUSG00000035804
UniProt: P01325
Position
19 D2; 19 46.76 cM
AA seq 108 aa
MALLVHFLPLLALLALWEPKPTQAFVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVED
PQVEQLELGGSPGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN
NT seq 327 nt   +upstreamnt  +downstreamnt
atggccctgttggtgcacttcctacccctgctggccctgcttgccctctgggagcccaaa
cccacccaggcttttgtcaaacagcatctttgtggtccccacctggtagaggctctctac
ctggtgtgtggggagcgtggcttcttctacacacccaagtcccgccgtgaagtggaggac
ccacaagtggaacaactggagctgggaggaagccccggggaccttcagaccttggcgttg
gaggtggcccggcagaagcgtggcattgtggatcagtgctgcaccagcatctgctccctc
taccagctggagaactactgcaactaa

KEGG   Mus musculus (mouse): 16334
Entry
16334             CDS       T01002                                 

Gene name
Ins2, AA986540, In, Ins-2, InsII, Mod, Mody, Mody4
Definition
(RefSeq) insulin II
  KO
K04526  insulin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04114  Oocyte meiosis
mmu04140  Autophagy - animal
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04810  Regulation of actin cytoskeleton
mmu04910  Insulin signaling pathway
mmu04911  Insulin secretion
mmu04913  Ovarian steroidogenesis
mmu04914  Progesterone-mediated oocyte maturation
mmu04917  Prolactin signaling pathway
mmu04923  Regulation of lipolysis in adipocytes
mmu04930  Type II diabetes mellitus
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease
mmu04940  Type I diabetes mellitus
mmu04950  Maturity onset diabetes of the young
mmu04960  Aldosterone-regulated sodium reabsorption
mmu05010  Alzheimer disease
mmu05215  Prostate cancer
mmu05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    16334 (Ins2)
   04014 Ras signaling pathway
    16334 (Ins2)
   04015 Rap1 signaling pathway
    16334 (Ins2)
   04066 HIF-1 signaling pathway
    16334 (Ins2)
   04068 FoxO signaling pathway
    16334 (Ins2)
   04072 Phospholipase D signaling pathway
    16334 (Ins2)
   04022 cGMP-PKG signaling pathway
    16334 (Ins2)
   04151 PI3K-Akt signaling pathway
    16334 (Ins2)
   04152 AMPK signaling pathway
    16334 (Ins2)
   04150 mTOR signaling pathway
    16334 (Ins2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    16334 (Ins2)
  09143 Cell growth and death
   04114 Oocyte meiosis
    16334 (Ins2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    16334 (Ins2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    16334 (Ins2)
   04910 Insulin signaling pathway
    16334 (Ins2)
   04923 Regulation of lipolysis in adipocytes
    16334 (Ins2)
   04913 Ovarian steroidogenesis
    16334 (Ins2)
   04914 Progesterone-mediated oocyte maturation
    16334 (Ins2)
   04917 Prolactin signaling pathway
    16334 (Ins2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    16334 (Ins2)
  09149 Aging
   04211 Longevity regulating pathway
    16334 (Ins2)
   04213 Longevity regulating pathway - multiple species
    16334 (Ins2)
 09160 Human Diseases
  09162 Cancer: specific types
   05215 Prostate cancer
    16334 (Ins2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    16334 (Ins2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    16334 (Ins2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    16334 (Ins2)
   04940 Type I diabetes mellitus
    16334 (Ins2)
   04950 Maturity onset diabetes of the young
    16334 (Ins2)
   04932 Non-alcoholic fatty liver disease
    16334 (Ins2)
   04931 Insulin resistance
    16334 (Ins2)
SSDB
Motif
Pfam: Insulin Ins_beta
Other DBs
NCBI-GeneID: 16334
NCBI-ProteinID: NP_001172012
MGI: 96573
Ensembl: ENSMUSG00000000215
Vega: OTTMUSG00000018794
UniProt: P01326 Q5EEX1
Position
7 F5; 7 88.0 cM
AA seq 110 aa
MALWMRFLPLLALLFLWESHPTQAFVKQHLCGSHLVEALYLVCGERGFFYTPMSRREVED
PQVAQLELGGGPGAGDLQTLALEVAQQKRGIVDQCCTSICSLYQLENYCN
NT seq 333 nt   +upstreamnt  +downstreamnt
atggccctgtggatgcgcttcctgcccctgctggccctgctcttcctctgggagtcccac
cccacccaggcttttgtcaagcagcacctttgtggttcccacctggtggaggctctctac
ctggtgtgtggggagcgtggcttcttctacacacccatgtcccgccgtgaagtggaggac
ccacaagtggcacaactggagctgggtggaggcccgggagcaggtgaccttcagaccttg
gcactggaggtggcccagcagaagcgtggcattgtagatcagtgctgcaccagcatctgc
tccctctaccagctggagaactactgcaactag

KEGG   Mus musculus (mouse): 17311
Entry
17311             CDS       T01002                                 

Gene name
Kitl, Clo, Con, Gb, Kit, Kitlg, Mgf, S, SC, SCF, SF, SLF, Sl, Ste, bl, blz, contrasted
Definition
(RefSeq) kit ligand
  KO
K05461  KIT ligand
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04640  Hematopoietic cell lineage
mmu04916  Melanogenesis
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    17311 (Kitl)
   04014 Ras signaling pathway
    17311 (Kitl)
   04015 Rap1 signaling pathway
    17311 (Kitl)
   04072 Phospholipase D signaling pathway
    17311 (Kitl)
   04151 PI3K-Akt signaling pathway
    17311 (Kitl)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    17311 (Kitl)
  09152 Endocrine system
   04916 Melanogenesis
    17311 (Kitl)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    17311 (Kitl)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    17311 (Kitl)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   17311 (Kitl)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 17311
NCBI-ProteinID: NP_038626
MGI: 96974
Ensembl: ENSMUSG00000019966
Vega: OTTMUSG00000020799
UniProt: P20826
Structure
PDB: 
2O27 2O26

Position
10 D1; 10 51.4 cM
AA seq 273 aa
MKKTQTWIITCIYLQLLLFNPLVKTKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAG
MDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAP
KNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVT
KPFMLPPVAASSLRNDSSSSNRKAAKAPEDSGLQWTAMALPALISLVIGFAFGALYWKKK
QSSLTRAVENIQINEEDNEISMLQQKEREFQEV
NT seq 822 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattatcacttgcatttatcttcaactgctcctatttaat
cctcttgtcaaaaccaaggagatctgcgggaatcctgtgactgataatgtaaaagacatt
acaaaactggtggcaaatcttccaaatgactatatgataaccctcaactatgtcgccggg
atggatgttttgcctagtcattgttggctacgagatatggtaatacaattatcactcagc
ttgactactcttctggacaagttctcaaatatttctgaaggcttgagtaattactccatc
atagacaaacttgggaaaatagtggatgacctcgtgttatgcatggaagaaaacgcaccg
aagaatataaaagaatctccgaagaggccagaaactagatcctttactcctgaagaattc
tttagtattttcaatagatccattgatgcctttaaggactttatggtggcatctgacact
agtgactgtgtgctctcttcaacattaggtcccgagaaagattccagagtcagtgtcaca
aaaccatttatgttaccccctgttgcagccagctcccttaggaatgacagcagtagcagt
aataggaaagccgcaaaggcccctgaagactcgggcctacaatggacagccatggcattg
ccggctctcatttcgcttgtaattggctttgcttttggagccttatactggaagaagaaa
cagtcaagtcttacaagggcagttgaaaatatacagattaatgaagaggataatgagata
agtatgttgcaacagaaagagagagaatttcaagaggtgtaa

KEGG   Mus musculus (mouse): 18048
Entry
18048             CDS       T01002                                 

Gene name
Klk1b4, Ng, Ngfa, alpha-NGF, mGk-4
Definition
(RefSeq) kallikrein 1-related pepidase b4
  KO
K05451  nerve growth factor, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    18048 (Klk1b4)
   04014 Ras signaling pathway
    18048 (Klk1b4)
   04015 Rap1 signaling pathway
    18048 (Klk1b4)
   04020 Calcium signaling pathway
    18048 (Klk1b4)
   04151 PI3K-Akt signaling pathway
    18048 (Klk1b4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    18048 (Klk1b4)
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    18048 (Klk1b4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    18048 (Klk1b4)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   18048 (Klk1b4)
SSDB
Motif
Pfam: Trypsin DUF1986 Trypsin_2
Other DBs
NCBI-GeneID: 18048
NCBI-ProteinID: NP_035045
MGI: 97320
Ensembl: ENSMUSG00000066513
Vega: OTTMUSG00000027268
UniProt: P00757 A0A1R3UGK0
Structure
PDB: 
1SGF

Position
7 B3; 7 28.72 cM
AA seq 256 aa
MWFLILFLALSLGGIDAAPPVQSQVDCENSQPWHVAVYRFNKYQCGGVLLDRNWVLTAAH
CYNDKYQVWLGKNNFLEDEPSDQHRLVSKAIPHPDFNMSLLNEHTPQPEDDYSNDLMLLR
LSKPADITDVVKPITLPTEEPKLGSTCLASGWGSTTPIKFKYPDDLQCVNLKLLPNEDCD
KAHEMKVTDAMLCAGEMDGGSYTCEHDSGGPLICDGILQGITSWGPEPCGEPTEPSVYTK
LIKFSSWIRETMANNP
NT seq 771 nt   +upstreamnt  +downstreamnt
atgtggttcctgatcctgttcctagccctgtccctaggagggattgatgctgcacctcct
gtccagtctcaagtggactgtgagaattcccaaccctggcatgtggctgtgtaccgcttc
aacaaatatcaatgcgggggagtcctgttggaccgcaactgggttctcacagctgcccac
tgctataacgacaagtaccaggtttggctgggcaaaaacaactttttggaggatgaacct
tctgaccaacaccggcttgtcagcaaagccatccctcaccctgacttcaacatgagcctc
ctgaatgagcacaccccacaacctgaggacgactacagcaatgacctgatgctgctccgc
ctcagcaagcctgctgacatcacagatgttgtgaagcccatcaccctgcccactgaggag
cccaagctggggagcacatgcctagcctcaggctggggcagcactacacccatcaagttc
aaatatccagatgatctccagtgtgtgaacctcaagctcctgcctaatgaggactgtgac
aaagcacatgaaatgaaggtgacagatgccatgctgtgtgcaggagagatggatggtggc
tcatacacttgtgagcatgactcaggaggcccactgatctgtgatggtattctccaaggt
atcacatcatggggccctgaaccatgtggtgagcccactgagccaagtgtctacaccaaa
cttattaagttcagctcctggataagagaaactatggcgaataacccctga

KEGG   Mus musculus (mouse): 18049
Entry
18049             CDS       T01002                                 

Gene name
Ngf, Ngfb, beta-NGF
Definition
(RefSeq) nerve growth factor
  KO
K02582  nerve growth factor, beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04151  PI3K-Akt signaling pathway
mmu04210  Apoptosis
mmu04722  Neurotrophin signaling pathway
mmu04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    18049 (Ngf)
   04014 Ras signaling pathway
    18049 (Ngf)
   04015 Rap1 signaling pathway
    18049 (Ngf)
   04020 Calcium signaling pathway
    18049 (Ngf)
   04151 PI3K-Akt signaling pathway
    18049 (Ngf)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    18049 (Ngf)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    18049 (Ngf)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    18049 (Ngf)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    18049 (Ngf)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    18049 (Ngf)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    18049 (Ngf)
Chaperones and folding catalysts [BR:mmu03110]
 Intramolecular chaperones
  Others
   18049 (Ngf)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   18049 (Ngf)
SSDB
Motif
Pfam: NGF Spaetzle
Other DBs
NCBI-GeneID: 18049
NCBI-ProteinID: NP_001106168
MGI: 97321
Ensembl: ENSMUSG00000027859
Vega: OTTMUSG00000054689
UniProt: P01139
Structure
PDB: 

Position
3 F2.2; 3 45.25 cM
AA seq 241 aa
MSMLFYTLITAFLIGVQAEPYTDSNVPEGDSVPEAHWTKLQHSLDTALRRARSAPTAPIA
ARVTGQTRNITVDPRLFKKRRLHSPRVLFSTQPPPTSSDTLDLDFQAHGTIPFNRTHRSK
RSSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCR
ASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRR
G
NT seq 726 nt   +upstreamnt  +downstreamnt
atgtccatgttgttctacactctgatcactgcgtttttgatcggcgtacaggcagaaccg
tacacagatagcaatgtcccagaaggagactctgtccctgaagcccactggactaaactt
cagcattcccttgacacagccctccgcagagcccgcagtgcccctactgcaccaatagct
gcccgagtgacagggcagacccgcaacatcactgtagaccccagactgtttaagaaacgg
agactccactcaccccgtgtgctgttcagcacccagcctccacccacctcttcagacact
ctggatctagacttccaggcccatggtacaatccctttcaacaggactcaccggagcaag
cgctcatccacccacccagtcttccacatgggggagttctcagtgtgtgacagtgtcagt
gtgtgggttggagataagaccacagccacagacatcaagggcaaggaggtgacagtgctg
gccgaggtgaacattaacaacagtgtattcagacagtacttttttgagaccaagtgccga
gcctccaatcctgttgagagtgggtgccggggcatcgactccaaacactggaactcatac
tgcaccacgactcacaccttcgtcaaggcgttgacaacagatgagaagcaggctgcctgg
aggttcatccggatagacacagcctgtgtgtgtgtgctcagcaggaaggctacaagaaga
ggctga

KEGG   Mus musculus (mouse): 18205
Entry
18205             CDS       T01002                                 

Gene name
Ntf3, AI316846, AI835689, HDNF, NGF-2, NT, NT-, Nt3, Ntf-, Ntf-3
Definition
(RefSeq) neurotrophin 3
  KO
K04356  neurotrophin 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04722  Neurotrophin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    18205 (Ntf3)
   04014 Ras signaling pathway
    18205 (Ntf3)
   04151 PI3K-Akt signaling pathway
    18205 (Ntf3)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    18205 (Ntf3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    18205 (Ntf3)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   18205 (Ntf3)
SSDB
Motif
Pfam: NGF Spaetzle
Other DBs
NCBI-GeneID: 18205
NCBI-ProteinID: NP_032768
MGI: 97380
Ensembl: ENSMUSG00000049107
Vega: OTTMUSG00000056716
UniProt: P20181 Q3V1A4
Position
6 F3; 6 60.45 cM
AA seq 258 aa
MSILFYVIFLAYLRGIQGNSMDQRSLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENYQ
STLPKAEAPREPEQGEATRSEFQPMIATDTELLRQQRRYNSPRVLLSDSTPLEPPPLYLM
EDYVGNPVVANRTSPRRKRYAEHKSHRGEYSVCDSESLWVTDKSSAIDIRGHQVTVLGEI
KTGNSPVKQYFYETRCKEARPVKNGCRGIDDKHWNSQCKTSQTYVRALTSENNKLVGWRW
IRIDTSCVCALSRKIGRT
NT seq 777 nt   +upstreamnt  +downstreamnt
atgtccatcttgttttatgtgatatttcttgcttatctccgtggcatccaaggcaacagc
atggatcaaaggagtttgccggaagactctctcaattccctcatcatcaagctgatccag
gcggatatcttgaaaaacaagctttccaaacagatggtggatgttaaggaaaattaccag
agcaccctgcccaaagcagaggcacccagggaaccagagcagggagaggccaccaggtca
gagttccagccaatgattgcaacggacacagagctactacggcaacagagacgctacaat
tcgccccgggtcctgctgagtgacagcacccctttggagccccctcccttatacctaatg
gaggattatgtgggcaacccggtggtagccaatagaacctcaccacggaggaaacgctat
gcagaacataagagtcaccgaggagagtactcagtgtgtgacagtgagagcctgtgggtg
accgacaagtcctcagccattgacattcggggacaccaggtcacagtgctgggggagatc
aaaaccggtaactctcctgtgaaacaatatttttatgaaacgagatgtaaagaagccagg
ccggtcaaaaacggttgcagggggattgatgacaaacactggaactctcagtgcaaaact
tcgcaaacctatgtccgagcactgacttcagaaaacaacaaactcgtaggctggcgctgg
atacgaatagacacttcctgtgtgtgtgccttgtcgagaaaaattggaagaacatga

KEGG   Mus musculus (mouse): 18590
Entry
18590             CDS       T01002                                 

Gene name
Pdgfa, PDGF-1
Definition
(RefSeq) platelet derived growth factor, alpha
  KO
K04359  platelet-derived growth factor subunit A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04540  Gap junction
mmu04630  JAK-STAT signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05206  MicroRNAs in cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05231  Choline metabolism in cancer
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    18590 (Pdgfa)
   04014 Ras signaling pathway
    18590 (Pdgfa)
   04015 Rap1 signaling pathway
    18590 (Pdgfa)
   04630 JAK-STAT signaling pathway
    18590 (Pdgfa)
   04020 Calcium signaling pathway
    18590 (Pdgfa)
   04072 Phospholipase D signaling pathway
    18590 (Pdgfa)
   04151 PI3K-Akt signaling pathway
    18590 (Pdgfa)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    18590 (Pdgfa)
   04540 Gap junction
    18590 (Pdgfa)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    18590 (Pdgfa)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18590 (Pdgfa)
   05202 Transcriptional misregulation in cancer
    18590 (Pdgfa)
   05206 MicroRNAs in cancer
    18590 (Pdgfa)
   05231 Choline metabolism in cancer
    18590 (Pdgfa)
  09162 Cancer: specific types
   05214 Glioma
    18590 (Pdgfa)
   05218 Melanoma
    18590 (Pdgfa)
   05215 Prostate cancer
    18590 (Pdgfa)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    18590 (Pdgfa)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    18590 (Pdgfa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    18590 (Pdgfa)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    18590 (Pdgfa)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   18590 (Pdgfa)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   18590 (Pdgfa)
SSDB
Motif
Pfam: PDGF_N PDGF
Other DBs
NCBI-GeneID: 18590
NCBI-ProteinID: NP_032834
MGI: 97527
Ensembl: ENSMUSG00000025856
Vega: OTTMUSG00000025151
UniProt: P20033 Q99L56
Position
5 G2; 5 77.65 cM
AA seq 196 aa
MRTWACLLLLGCGYLAHALAEEAEIPRELIERLARSQIHSIRDLQRLLEIDSVGAEDALE
TSLRAHGSHAINHVPEKRPVPIRRKRSIEEAIPAVCKTRTVIYEIPRSQVDPTSANFLIW
PPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACA
TSNLNPDHREEETDVR
NT seq 591 nt   +upstreamnt  +downstreamnt
atgaggacctgggcttgcctgctgctcctcggctgcggatacctcgcccatgccctggcc
gaggaagccgagataccccgggagttgatcgagcggctggctcgaagtcagatccacagc
atccgggacctccagcgactcttggagatagactccgtaggggctgaggatgccttggag
acaagtctgagagcccatgggtcccatgccattaaccatgtgcccgagaagcggcctgtg
cccattcgcaggaagagaagtattgaggaagccattcctgcagtttgcaagaccaggacg
gtcatttacgagatacctcggagccaggtggaccccacatcggccaacttcctgatctgg
cccccatgtgtggaggtgaagcgctgcactggctgttgtaacaccagcagcgtcaagtgc
cagccttcacgggtccaccaccgcagtgtcaaggtggccaaagtggagtatgtcaggaag
aagccaaaattgaaagaggtccaggtgaggttagaggaacacctggagtgtgcatgtgcg
acctccaacctgaacccagaccatcgggaggaggagacagatgtgaggtga

KEGG   Mus musculus (mouse): 18591
Entry
18591             CDS       T01002                                 

Gene name
Pdgfb, PDGF-, PDGF-2, PDGF-B, Sis, c-sis
Definition
(RefSeq) platelet derived growth factor, B polypeptide
  KO
K17386  platelet-derived growth factor subunit B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04540  Gap junction
mmu04630  JAK-STAT signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05200  Pathways in cancer
mmu05206  MicroRNAs in cancer
mmu05211  Renal cell carcinoma
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05231  Choline metabolism in cancer
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    18591 (Pdgfb)
   04014 Ras signaling pathway
    18591 (Pdgfb)
   04015 Rap1 signaling pathway
    18591 (Pdgfb)
   04630 JAK-STAT signaling pathway
    18591 (Pdgfb)
   04020 Calcium signaling pathway
    18591 (Pdgfb)
   04072 Phospholipase D signaling pathway
    18591 (Pdgfb)
   04151 PI3K-Akt signaling pathway
    18591 (Pdgfb)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    18591 (Pdgfb)
   04540 Gap junction
    18591 (Pdgfb)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    18591 (Pdgfb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18591 (Pdgfb)
   05206 MicroRNAs in cancer
    18591 (Pdgfb)
   05231 Choline metabolism in cancer
    18591 (Pdgfb)
  09162 Cancer: specific types
   05214 Glioma
    18591 (Pdgfb)
   05218 Melanoma
    18591 (Pdgfb)
   05211 Renal cell carcinoma
    18591 (Pdgfb)
   05215 Prostate cancer
    18591 (Pdgfb)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    18591 (Pdgfb)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    18591 (Pdgfb)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    18591 (Pdgfb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    18591 (Pdgfb)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    18591 (Pdgfb)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   18591 (Pdgfb)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   18591 (Pdgfb)
SSDB
Motif
Pfam: PDGF PDGF_N
Other DBs
NCBI-GeneID: 18591
NCBI-ProteinID: NP_035187
MGI: 97528
Ensembl: ENSMUSG00000000489
UniProt: P31240 A0A0R4IZW4
Position
15 E1; 15 37.85 cM
AA seq 241 aa
MNRCWALFLPLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHRDSVDEDGAEL
DLNMTRAHSGVELESSSRGRRSLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLV
WPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKC
ETVVTPRPVTRSPGTSREQRAKTPQARVTIRTVRIRRPPKGKHRKFKHTHDKAALKETLG
A
NT seq 726 nt   +upstreamnt  +downstreamnt
atgaatcgctgctgggcgctcttccttcctctctgctgctacctgcgtctggtcagcgcc
gagggggatcccattcctgaggaactgtatgaaatgctgagcgaccactccatccgctcc
tttgatgatcttcagcgcctgctgcacagagactccgtagatgaagatggggctgagctg
gacttgaacatgacccgagcacactccggagtcgagttggaaagctcatctcgagggagg
aggagcctagggtccctggcagcagcagagcctgctgtaatcgccgagtgcaagacgcgc
acagaggtgttccagatctctcggaacctcatcgatcgcaccaacgccaacttcctggtg
tggccgccctgtgtggaggtgcagcgctgctccggctgctgcaataaccgcaatgtgcaa
tgccgggcctcgcaggtgcagatgcggccggtccaggtgagaaagattgagattgtgcga
aagaagcccatcttcaagaaggccacagtgaccttggaggaccacctcgcctgcaagtgt
gagacagtagtgacccctcggcctgtgactagaagtcctgggacatccagggagcagcga
gccaagacgcctcaagctcgggtgaccattcggacggtgagaatccgccggccccccaaa
ggcaagcaccgaaagtttaagcacacccatgacaaggcggccctgaaggagaccctcgga
gcctag

KEGG   Mus musculus (mouse): 18654
Entry
18654             CDS       T01002                                 

Gene name
Pgf, AI854365, PI, PIGF, PL, Plgf
Definition
(RefSeq) placental growth factor
  KO
K16859  placenta growth factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    18654 (Pgf)
   04014 Ras signaling pathway
    18654 (Pgf)
   04015 Rap1 signaling pathway
    18654 (Pgf)
   04151 PI3K-Akt signaling pathway
    18654 (Pgf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    18654 (Pgf)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18654 (Pgf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    18654 (Pgf)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   18654 (Pgf)
SSDB
Motif
Pfam: PDGF
Other DBs
NCBI-GeneID: 18654
NCBI-ProteinID: NP_032853
MGI: 105095
Ensembl: ENSMUSG00000004791
UniProt: P49764 Q544A5
Position
12 D1; 12 39.58 cM
AA seq 158 aa
MLVMKLFTCFLQVLAGLAVHSQGALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDE
YPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFS
QDVLCECRPILETTKAERRKTKGKRKRSRNSQTEEPHP
NT seq 477 nt   +upstreamnt  +downstreamnt
atgctggtcatgaagctgttcacttgcttcttacaggtcctagctgggttggctgtgcat
tcccagggggccctgtctgctgggaacaactcaacagaagtggaagtggtgcctttcaac
gaagtgtggggtcgcagctactgtcggcccatggagaagctggtgtacatcttggatgaa
taccctgatgaggtgtctcacatattcagtccgtcctgtgtccttctgagtcgctgtagt
ggctgctgtggtgatgaaggtctgcactgtgtgccgataaagacagccaacatcactatg
cagatcttgaagattccccccaatcgggatccacatttctatgtggagatgacattttct
caggatgtgctctgtgaatgcagacctattctggagacgacaaaggcagaaaggaggaaa
accaaggggaagaggaagaggagtagaaactcacagactgaggaaccccacccgtga

KEGG   Mus musculus (mouse): 21802
Entry
21802             CDS       T01002                                 

Gene name
Tgfa, wa-1, wa1
Definition
(RefSeq) transforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04915  Estrogen signaling pathway
mmu05200  Pathways in cancer
mmu05210  Colorectal cancer
mmu05211  Renal cell carcinoma
mmu05212  Pancreatic cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05223  Non-small cell lung cancer
mmu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    21802 (Tgfa)
   04012 ErbB signaling pathway
    21802 (Tgfa)
   04014 Ras signaling pathway
    21802 (Tgfa)
   04151 PI3K-Akt signaling pathway
    21802 (Tgfa)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    21802 (Tgfa)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    21802 (Tgfa)
  09162 Cancer: specific types
   05210 Colorectal cancer
    21802 (Tgfa)
   05212 Pancreatic cancer
    21802 (Tgfa)
   05225 Hepatocellular carcinoma
    21802 (Tgfa)
   05214 Glioma
    21802 (Tgfa)
   05211 Renal cell carcinoma
    21802 (Tgfa)
   05215 Prostate cancer
    21802 (Tgfa)
   05223 Non-small cell lung cancer
    21802 (Tgfa)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    21802 (Tgfa)
SSDB
Motif
Pfam: EGF TMEM154
Other DBs
NCBI-GeneID: 21802
NCBI-ProteinID: NP_112476
MGI: 98724
Ensembl: ENSMUSG00000029999
Vega: OTTMUSG00000049992
UniProt: P48030 Q545E4
Position
6 D1; 6 37.62 cM
AA seq 159 aa
MVPATGQLALLALGILLAVCQALENSTSPLSDSPVAAAVVSHFNKCPDSHTQYCFHGTCR
FLVQEEKPACVCHSGYVGVRCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLI
HCCQLRKHCEWCRALVCRHEKPSALLKGRTACCHSETVV
NT seq 480 nt   +upstreamnt  +downstreamnt
atggtccccgcgaccggacagctcgctctgctagcgctgggtatcctgttagctgtgtgc
caggctctggagaacagcacatcccccctgagtgactcacccgtggcggctgcagtggtg
tctcacttcaacaagtgcccagattcccacactcagtactgcttccatggaacctgccgg
tttttggtgcaggaagagaagccagcatgtgtctgccactctgggtacgtgggtgttcgc
tgtgagcatgcagacctcctggctgtggtggctgccagccagaagaagcaagccatcact
gccctggtggtggtctccattgtggccctggctgtcctcattatcacctgtgtgctgatc
cactgctgtcagctccgcaaacactgtgagtggtgccgtgccctcgtctgcagacatgag
aagcccagcgccctcctgaagggaaggactgcttgctgccactctgagacagtggtctga

KEGG   Mus musculus (mouse): 22339
Entry
22339             CDS       T01002                                 

Gene name
Vegfa, V, VEGF12, VEGF16, VEGF18, Veg, Vegf, Vpf
Definition
(RefSeq) vascular endothelial growth factor A
  KO
K05448  vascular endothelial growth factor A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04370  VEGF signaling pathway
mmu04510  Focal adhesion
mmu04926  Relaxin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05211  Renal cell carcinoma
mmu05212  Pancreatic cancer
mmu05219  Bladder cancer
mmu05323  Rheumatoid arthritis
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    22339 (Vegfa)
   04014 Ras signaling pathway
    22339 (Vegfa)
   04015 Rap1 signaling pathway
    22339 (Vegfa)
   04370 VEGF signaling pathway
    22339 (Vegfa)
   04066 HIF-1 signaling pathway
    22339 (Vegfa)
   04020 Calcium signaling pathway
    22339 (Vegfa)
   04151 PI3K-Akt signaling pathway
    22339 (Vegfa)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    22339 (Vegfa)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    22339 (Vegfa)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    22339 (Vegfa)
   05206 MicroRNAs in cancer
    22339 (Vegfa)
   05205 Proteoglycans in cancer
    22339 (Vegfa)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    22339 (Vegfa)
   05211 Renal cell carcinoma
    22339 (Vegfa)
   05219 Bladder cancer
    22339 (Vegfa)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    22339 (Vegfa)
   05167 Kaposi sarcoma-associated herpesvirus infection
    22339 (Vegfa)
   05165 Human papillomavirus infection
    22339 (Vegfa)
  09163 Immune disease
   05323 Rheumatoid arthritis
    22339 (Vegfa)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    22339 (Vegfa)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    22339 (Vegfa)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    22339 (Vegfa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    22339 (Vegfa)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    22339 (Vegfa)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   22339 (Vegfa)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   22339 (Vegfa)
SSDB
Motif
Pfam: VEGF_C PDGF Cnd1_N
Other DBs
NCBI-GeneID: 22339
NCBI-ProteinID: NP_001273985
MGI: 103178
Ensembl: ENSMUSG00000023951
Vega: OTTMUSG00000016285
UniProt: Q00731
Position
17 C; 17 22.79 cM
AA seq 214 aa
MNFLLSWVHWTLALLLYLHHAKWSQAAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDI
FQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMS
FLQHSRCECRPKKDRTKPEKKSVRGKGKGQKRKRKKSRFKSWSVHCEPCSERRKHLFVQD
PQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
NT seq 645 nt   +upstreamnt  +downstreamnt
atgaactttctgctctcttgggtgcactggaccctggctttactgctgtacctccaccat
gccaagtggtcccaggctgcacccacgacagaaggagagcagaagtcccatgaagtgatc
aagttcatggatgtctaccagcgaagctactgccgtccgattgagaccctggtggacatc
ttccaggagtaccccgacgagatagagtacatcttcaagccgtcctgtgtgccgctgatg
cgctgtgcaggctgctgtaacgatgaagccctggagtgcgtgcccacgtcagagagcaac
atcaccatgcagatcatgcggatcaaacctcaccaaagccagcacataggagagatgagc
ttcctacagcacagcagatgtgaatgcagaccaaagaaagacagaacaaagccagaaaaa
aaatcagttcgaggaaagggaaagggtcaaaaacgaaagcgcaagaaatcccggtttaaa
tcctggagcgttcactgtgagccttgttcagagcggagaaagcatttgtttgtccaagat
ccgcagacgtgtaaatgttcctgcaaaaacacagactcgcgttgcaaggcgaggcagctt
gagttaaacgaacgtacttgcagatgtgacaagccaaggcggtga

KEGG   Mus musculus (mouse): 22340
Entry
22340             CDS       T01002                                 

Gene name
Vegfb, V, VEGF-, VEGF-B, Vrf
Definition
(RefSeq) vascular endothelial growth factor B
  KO
K16858  vascular endothelial growth factor B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04926  Relaxin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    22340 (Vegfb)
   04014 Ras signaling pathway
    22340 (Vegfb)
   04015 Rap1 signaling pathway
    22340 (Vegfb)
   04020 Calcium signaling pathway
    22340 (Vegfb)
   04151 PI3K-Akt signaling pathway
    22340 (Vegfb)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    22340 (Vegfb)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    22340 (Vegfb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    22340 (Vegfb)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    22340 (Vegfb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    22340 (Vegfb)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   22340 (Vegfb)
SSDB
Motif
Pfam: PDGF
Other DBs
NCBI-GeneID: 22340
NCBI-ProteinID: NP_035827
MGI: 106199
Ensembl: ENSMUSG00000024962
Vega: OTTMUSG00000033015
UniProt: P49766
Position
19; 19 A
AA seq 207 aa
MSPLLRRLLLVALLQLARTQAPVSQFDGPSHQKKVVPWIDVYARATCQPREVVVPLSMEL
MGNVVKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIQYPSSQLGEMSLEEHS
QCECRPKKKESAVKPDRVAIPHHRPQPRSVPGWDSTPGASSPADIIHPTPAPGSSARLAP
SAVNALTPGPAAAAADAAASSIAKGGA
NT seq 624 nt   +upstreamnt  +downstreamnt
atgagccccctgctccgtcgcctgctgcttgttgcactgctgcagctggctcgcacccag
gcccctgtgtcccagtttgatggccccagccaccagaagaaagtggtgccatggatagac
gtttatgcacgtgccacatgccagcccagggaggtggtggtgcctctgagcatggaactc
atgggcaatgtggtcaaacaactagtgcccagctgtgtgactgtgcagcgctgtggtggc
tgctgccctgacgatggcctggaatgtgtgcccactgggcaacaccaagtccgaatgcag
atcctcatgatccagtacccgagcagtcagctgggggagatgtccctggaagaacacagc
caatgtgaatgcagaccaaaaaaaaaggagagtgctgtgaagccagacagggttgccata
ccccaccaccgtccccagccccgctctgttccgggctgggactctaccccgggagcatcc
tccccagctgacatcatccatcccactccagccccaggatcctctgcccgccttgcaccc
agcgccgtcaacgccctgacccccggacctgccgctgccgctgcagacgccgccgcttcc
tccattgccaagggcggggcttag

KEGG   Mus musculus (mouse): 22341
Entry
22341             CDS       T01002                                 

Gene name
Vegfc, AW228853, VEGF-, VEGF-C
Definition
(RefSeq) vascular endothelial growth factor C
  KO
K05449  vascular endothelial growth factor C/D
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04668  TNF signaling pathway
mmu04926  Relaxin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    22341 (Vegfc)
   04014 Ras signaling pathway
    22341 (Vegfc)
   04015 Rap1 signaling pathway
    22341 (Vegfc)
   04668 TNF signaling pathway
    22341 (Vegfc)
   04020 Calcium signaling pathway
    22341 (Vegfc)
   04151 PI3K-Akt signaling pathway
    22341 (Vegfc)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    22341 (Vegfc)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    22341 (Vegfc)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    22341 (Vegfc)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    22341 (Vegfc)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    22341 (Vegfc)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   22341 (Vegfc)
SSDB
Motif
Pfam: PDGF CXCXC
Other DBs
NCBI-GeneID: 22341
NCBI-ProteinID: NP_033532
MGI: 109124
Ensembl: ENSMUSG00000031520
Vega: OTTMUSG00000060617
UniProt: P97953
Position
8; 8 B1.3
AA seq 415 aa
MHLLCFLSLACSLLAAALIPSPREAPATVAAFESGLGFSEAEPDGGEVKAFEGKDLEEQL
RSVSSVDELMSVLYPDYWKMYKCQLRKGGWQQPTLNTRTGDSVKFAAAHYNTEILKSIDN
EWRKTQCMPREVCIDVGKEFGAATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTGYLSKT
LFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRRSLPATLPQCQAANKTCP
TNYVWNNYMCRCLAQQDFIFYSNVEDDSTNGFHDVCGPNKELDEDTCQCVCKGGLRPSSC
GPHKELDRDSCQCVCKNKLFPNSCGANREFDENTCQCVCKRTCPRNQPLNPGKCACECTE
NTQKCFLKGKKFHHQTCSCYRRPCANRLKHCDPGLSFSEEVCRCVPSYWKRPHLN
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgcacttgctgtgcttcttgtctctggcgtgttccctgctcgccgctgcgctgatcccc
agtccgcgcgaggcgcccgccaccgtcgccgccttcgagtcgggactgggcttctcggaa
gcggagcccgacgggggcgaggtcaaggcttttgaaggcaaagacctggaggagcagttg
cggtctgtgtccagcgtagatgagctgatgtctgtcctgtacccagactactggaaaatg
tacaagtgccagctgcggaaaggcggctggcagcagcccaccctcaataccaggacaggg
gacagtgtaaaatttgctgctgcacattataacacagagatcctgaaaagtattgataat
gagtggagaaagactcaatgcatgccacgtgaggtgtgtatagatgtggggaaggagttt
ggagcagccacaaacaccttctttaaacctccatgtgtgtccgtctacagatgtgggggt
tgctgcaacagcgaggggctgcagtgcatgaacaccagcacaggttacctcagcaagacg
ttgtttgaaattacagtgcctctctcacaaggccccaaaccagtcacaatcagttttgcc
aatcacacttcctgccggtgcatgtctaaactggatgtttacagacaagttcattcaatt
attagacgttctctgccagcaacattaccacagtgtcaggcagctaacaagacatgtcca
acaaactatgtgtggaataactacatgtgccgatgcctggctcagcaggattttatcttt
tattcaaatgttgaagatgactcaaccaatggattccatgatgtctgtggacccaacaag
gagctggatgaagacacctgtcagtgtgtctgcaagggggggcttcggccatctagttgt
ggaccccacaaagaactagatagagactcatgtcagtgtgtctgtaaaaacaaacttttc
cctaattcatgtggagccaacagggaatttgatgagaatacatgtcagtgtgtatgtaaa
agaacgtgtccaagaaatcagcccctgaatcctgggaaatgtgcctgtgaatgtacagaa
aacacacagaagtgcttccttaaagggaagaagttccaccatcaaacatgcagttgttac
agaagaccgtgtgcgaatcgactgaagcattgtgatccaggactgtcctttagtgaagaa
gtatgccgctgtgtcccatcgtattggaaaaggccacatctgaactaa

KEGG   Mus musculus (mouse): 54635
Entry
54635             CDS       T01002                                 

Gene name
Pdgfc, 1110064L01Rik, AI647969, PDGF-, PDGF-C, SCDGF, VEGF-E
Definition
(RefSeq) platelet-derived growth factor, C polypeptide
  KO
K05450  platelet derived growth factor C/D
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04540  Gap junction
mmu04810  Regulation of actin cytoskeleton
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    54635 (Pdgfc)
   04014 Ras signaling pathway
    54635 (Pdgfc)
   04015 Rap1 signaling pathway
    54635 (Pdgfc)
   04020 Calcium signaling pathway
    54635 (Pdgfc)
   04072 Phospholipase D signaling pathway
    54635 (Pdgfc)
   04151 PI3K-Akt signaling pathway
    54635 (Pdgfc)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    54635 (Pdgfc)
   04540 Gap junction
    54635 (Pdgfc)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    54635 (Pdgfc)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    54635 (Pdgfc)
  09162 Cancer: specific types
   05218 Melanoma
    54635 (Pdgfc)
   05215 Prostate cancer
    54635 (Pdgfc)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    54635 (Pdgfc)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    54635 (Pdgfc)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   54635 (Pdgfc)
SSDB
Motif
Pfam: CUB PDGF
Other DBs
NCBI-GeneID: 54635
NCBI-ProteinID: NP_064355
MGI: 1859631
Ensembl: ENSMUSG00000028019
Vega: OTTMUSG00000028878
UniProt: Q8CI19
Position
3; 3 E3
AA seq 345 aa
MLLLGLLLLTSALAGQRTGTRAESNLSSKLQLSSDKEQNGVQDPRHERVVTISGNGSIHS
PKFPHTYPRNMVLVWRLVAVDENVRIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGSVL
GRWCGSGTVPGKQTSKGNHIRIRFVSDEYFPSEPGFCIHYSIIMPQVTETTSPSVLPPSS
LSLDLLNNAVTAFSTLEELIRYLEPDRWQVDLDSLYKPTWQLLGKAFLYGKKSKVVNLNL
LKEEVKLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPRK
VTKKYHEVLQLRPKTGVKGLHKSLTDVALEHHEECDCVCRGNAGG
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgctcctcctcggcctcctcctgctgacatctgccctggccggccaaagaacggggact
cgggctgagtccaacctgagcagcaagttgcagctctccagcgacaaggaacagaacgga
gtgcaagatccccggcatgagagagttgtcactatatctggtaatgggagcatccacagc
ccgaagtttcctcatacatacccaagaaatatggtgctggtgtggagattagttgcagta
gatgaaaatgtgcggatccagctgacatttgatgagagatttgggctggaagatccagaa
gacgatatatgcaagtatgattttgtagaagttgaggagcccagtgatggaagtgtttta
ggacgctggtgtggttctgggactgtgccaggaaagcagacttctaaaggaaatcatatc
aggataagatttgtatctgatgagtattttccatctgaacccggattctgcatccactac
agtattatcatgccacaagtcacagaaaccacgagtccttcggtgttgcccccttcatct
ttgtcattggacctgctcaacaatgctgtgactgccttcagtaccttggaagagctgatt
cggtacctagagccagatcgatggcaggtggacttggacagcctctacaagccaacatgg
cagcttttgggcaaggctttcctgtatgggaaaaaaagcaaagtggtgaatctgaatctc
ctcaaggaagaggtaaaactctacagctgcacaccccggaacttctcagtgtccatacgg
gaagagctaaagaggacagataccatattctggccaggttgtctcctggtcaagcgctgt
ggaggaaattgtgcctgttgtctccataattgcaatgaatgtcagtgtgtcccacgtaaa
gttacaaaaaagtaccatgaggtccttcagttgagaccaaaaactggagtcaagggattg
cataagtcactcactgatgtggctctggaacaccacgaggaatgtgactgtgtgtgtaga
ggaaacgcaggagggtaa

KEGG   Mus musculus (mouse): 56636
Entry
56636             CDS       T01002                                 

Gene name
Fgf21
Definition
(RefSeq) fibroblast growth factor 21
  KO
K22429  fibroblast growth factor 21
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04714  Thermogenesis
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    56636 (Fgf21)
   04014 Ras signaling pathway
    56636 (Fgf21)
   04015 Rap1 signaling pathway
    56636 (Fgf21)
   04020 Calcium signaling pathway
    56636 (Fgf21)
   04151 PI3K-Akt signaling pathway
    56636 (Fgf21)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    56636 (Fgf21)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    56636 (Fgf21)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    56636 (Fgf21)
  09162 Cancer: specific types
   05226 Gastric cancer
    56636 (Fgf21)
   05218 Melanoma
    56636 (Fgf21)
   05224 Breast cancer
    56636 (Fgf21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    56636 (Fgf21)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    56636 (Fgf21)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   56636 (Fgf21)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   56636 (Fgf21)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 56636
NCBI-ProteinID: NP_064397
MGI: 1861377
Ensembl: ENSMUSG00000030827
Vega: OTTMUSG00000058294
UniProt: Q9JJN1
Position
7; 7 B3
AA seq 210 aa
MEWMRSRVGTLGLWVRLLLAVFLLGVYQAYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEA
HLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPE
ACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAG
FLPPEPPDVGSSDPLSMVEPLQGRSPSYAS
NT seq 633 nt   +upstreamnt  +downstreamnt
atggaatggatgagatctagagttgggaccctgggactgtgggtccgactgctgctggct
gtcttcctgctgggggtctaccaagcataccccatccctgactccagccccctcctccag
tttgggggtcaagtccggcagaggtacctctacacagatgacgaccaagacactgaagcc
cacctggagatcagggaggatggaacagtggtaggcgcagcacaccgcagtccagaaagt
ctcctggagctcaaagccttgaagccaggggtcattcaaatcctgggtgtcaaagcctct
aggtttctttgccaacagccagatggagctctctatggatcgcctcactttgatcctgag
gcctgcagcttcagagaactgctgctggaggacggttacaatgtgtaccagtctgaagcc
catggcctgcccctgcgtctgcctcagaaggactccccaaaccaggatgcaacatcctgg
ggacctgtgcgcttcctgcccatgccaggcctgctccacgagccccaagaccaagcagga
ttcctgcccccagagcccccagatgtgggctcctctgaccccctgagcatggtagagcct
ttacagggccgaagccccagctatgcgtcctga

KEGG   Mus musculus (mouse): 64654
Entry
64654             CDS       T01002                                 

Gene name
Fgf23
Definition
(RefSeq) fibroblast growth factor 23
  KO
K22428  fibroblast growth factor 23
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu05200  Pathways in cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    64654 (Fgf23)
   04014 Ras signaling pathway
    64654 (Fgf23)
   04015 Rap1 signaling pathway
    64654 (Fgf23)
   04020 Calcium signaling pathway
    64654 (Fgf23)
   04151 PI3K-Akt signaling pathway
    64654 (Fgf23)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    64654 (Fgf23)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    64654 (Fgf23)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    64654 (Fgf23)
  09162 Cancer: specific types
   05226 Gastric cancer
    64654 (Fgf23)
   05218 Melanoma
    64654 (Fgf23)
   05224 Breast cancer
    64654 (Fgf23)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    64654 (Fgf23)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    64654 (Fgf23)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   64654 (Fgf23)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   64654 (Fgf23)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 64654
NCBI-ProteinID: NP_073148
MGI: 1891427
Ensembl: ENSMUSG00000000182
Vega: OTTMUSG00000056344
UniProt: Q9EPC2 Q3U1V5
Position
6; 6 F3
AA seq 251 aa
MLGTCLRLLVGVLCTVCSLGTARAYPDTSPLLGSNWGSLTHLYTATARTSYHLQIHRDGH
VDGTPHQTIYSALMITSEDAGSVVITGAMTRRFLCMDLHGNIFGSLHFSPENCKFRQWTL
ENGYDVYLSQKHHYLVSLGRAKRIFQPGTNPPPFSQFLARRNEVPLLHFYTVRPRRHTRS
AEDPPERDPLNVLKPRPRATPVPVSCSRELPSAEEGGPAASDPLGVLRRGRGDARGGAGG
ADRCRPFPRFV
NT seq 756 nt   +upstreamnt  +downstreamnt
atgctagggacctgccttagactcctggtgggcgtgctctgcactgtctgcagcttgggc
actgctagagcctatccggacacttccccattgcttggctccaactggggaagcctgacc
cacctgtacacggctacagccaggaccagctatcacctacagatccatagggatggtcat
gtagatggcaccccccatcagaccatctacagtgccctgatgattacatcagaggacgcc
ggctctgtggtgataacaggagccatgactcgaaggttcctttgtatggatctccacggc
aacatttttggatcgcttcacttcagcccagagaattgcaagttccgccagtggacgctg
gagaatggctatgacgtctacttgtcgcagaagcatcactacctggtgagcctgggccgc
gccaagcgcatcttccagccgggcaccaacccgccgcccttctcccagttcctggctcgc
aggaacgaggtcccgctgctgcatttctacactgttcgcccacggcgccacacgcgcagc
gccgaggacccaccggagcgcgacccactgaacgtgctcaagccgcggccccgcgccacg
cctgtgcctgtatcctgctctcgcgagctgccgagcgcagaggaaggtggccccgcagcc
agcgatcctctgggggtgctgcgcagaggccgtggagatgctcgcgggggcgcgggaggc
gcggataggtgtcgcccctttcccaggttcgtctag

KEGG   Mus musculus (mouse): 67112
Entry
67112             CDS       T01002                                 

Gene name
Fgf22, 2210414E06Rik, FGF-22
Definition
(RefSeq) fibroblast growth factor 22
  KO
K04358  fibroblast growth factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    67112 (Fgf22)
   04014 Ras signaling pathway
    67112 (Fgf22)
   04015 Rap1 signaling pathway
    67112 (Fgf22)
   04020 Calcium signaling pathway
    67112 (Fgf22)
   04151 PI3K-Akt signaling pathway
    67112 (Fgf22)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    67112 (Fgf22)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    67112 (Fgf22)
  09162 Cancer: specific types
   05226 Gastric cancer
    67112 (Fgf22)
   05218 Melanoma
    67112 (Fgf22)
   05224 Breast cancer
    67112 (Fgf22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    67112 (Fgf22)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    67112 (Fgf22)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   67112 (Fgf22)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   67112 (Fgf22)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 67112
NCBI-ProteinID: NP_075793
MGI: 1914362
Ensembl: ENSMUSG00000020327
UniProt: Q9ESS2
Position
10; 10 C1
AA seq 162 aa
MRSRLWLGLAWLLLARAPGAPGGYPHLEGDVRWRRLFSSTHFFLRVDLGGRVQGTRWRHG
QDSIVEIRSVRVGTVVIKAVYSGFYVAMNRRGRLYGSRVYSVDCRFRERIEENGYNTYAS
RRWRHRGRPMFLALDSQGIPRQGRRTRRHQLSTHFLPVLVSS
NT seq 489 nt   +upstreamnt  +downstreamnt
atgcgcagccgcctctggctgggcctagcctggctgctgttggcgcgggcaccgggcgct
ccgggagggtacccgcatctggagggcgacgtgcgctggcgccgcctcttctcctccact
cactttttcctgcgtgtggaccttggtggtcgggtgcaggggacgcgttggcggcacggc
caggacagtatagtggagatccgttctgtccgtgtgggcactgtggtgatcaaagctgtg
tactcaggcttctatgtggccatgaatcgcaggggccgcctctatgggtcgcgggtctac
tctgtggactgtaggttccgggagcgcatcgaggagaacggctacaacacatacgcctcg
cgacgttggaggcaccgcggccgacccatgttcctggcacttgacagccaaggcattccc
aggcaaggcagacggacacgacggcaccaactgtccacacacttcctgccagtcttggtc
tcgtcttga

KEGG   Mus musculus (mouse): 71785
Entry
71785             CDS       T01002                                 

Gene name
Pdgfd, 1110003I09Rik
Definition
(RefSeq) platelet-derived growth factor, D polypeptide
  KO
K05450  platelet derived growth factor C/D
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04540  Gap junction
mmu04810  Regulation of actin cytoskeleton
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    71785 (Pdgfd)
   04014 Ras signaling pathway
    71785 (Pdgfd)
   04015 Rap1 signaling pathway
    71785 (Pdgfd)
   04020 Calcium signaling pathway
    71785 (Pdgfd)
   04072 Phospholipase D signaling pathway
    71785 (Pdgfd)
   04151 PI3K-Akt signaling pathway
    71785 (Pdgfd)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    71785 (Pdgfd)
   04540 Gap junction
    71785 (Pdgfd)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    71785 (Pdgfd)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    71785 (Pdgfd)
  09162 Cancer: specific types
   05218 Melanoma
    71785 (Pdgfd)
   05215 Prostate cancer
    71785 (Pdgfd)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    71785 (Pdgfd)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    71785 (Pdgfd)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   71785 (Pdgfd)
SSDB
Motif
Pfam: CUB PDGF
Other DBs
NCBI-GeneID: 71785
NCBI-ProteinID: NP_082200
MGI: 1919035
Ensembl: ENSMUSG00000032006
Vega: OTTMUSG00000062234
UniProt: Q925I7
Position
9; 9 A1
AA seq 370 aa
MQRLVLVSILLCANFSCYPDTFATPQRASIKALRNANLRRDESNHLTDLYQREENIQVTS
NGHVQSPRFPNSYPRNLLLTWWLRSQEKTRIQLSFDHQFGLEEAENDICRYDFVEVEEVS
ESSTVVRGRWCGHKEIPPRITSRTNQIKITFKSDDYFVAKPGFKIYYSFVEDFQPEAASE
TNWESVTSSFSGVSYHSPSITDPTLTADALDKTVAEFDTVEDLLKHFNPVSWQDDLENLY
LDTPHYRGRSYHDRKSKVDLDRLNDDVKRYSCTPRNHSVNLREELKLTNAVFFPRCLLVQ
RCGGNCGCGTVNWKSCTCSSGKTVKKYHEVLKFEPGHFKRRGKAKNMALVDIQLDHHERC
DCICSSRPPR
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgcaacggctcgttttagtctccattctcctgtgcgcgaactttagctgctatccggac
acttttgcgactccgcagagagcatccatcaaagctttgcgcaatgccaacctcaggaga
gatgagagcaatcacctcacagacttgtaccagagagaggagaacattcaggtgacaagc
aatggccatgtgcagagtcctcgcttcccgaacagctacccaaggaacctgcttctgaca
tggtggctccgttcccaggagaaaacacggatacaactgtcctttgaccatcaattcgga
ctagaggaagcagaaaatgacatttgtaggtatgactttgtggaagttgaagaagtctca
gagagcagcactgttgtcagaggaagatggtgtggccacaaggagatccctccaaggata
acgtcaagaacaaaccagattaaaatcacatttaagtctgatgactactttgtggcaaaa
cctggattcaagatttattattcatttgtggaagatttccaaccggaagcagcctcagag
accaactgggaatcagtcacaagctctttctctggggtgtcctatcactctccatcaata
acggaccccactctcactgctgatgccctggacaaaactgtcgcagaattcgataccgtg
gaagatctacttaagcacttcaatccagtgtcttggcaagatgatctggagaatttgtat
ctggacacccctcattatagaggcaggtcataccatgatcggaagtccaaagtggacctg
gacaggctcaatgatgatgtcaagcgttacagttgcactcccaggaatcactctgtgaac
ctcagggaggagctgaagctgaccaatgcagtcttcttcccacgatgcctcctcgtgcag
cgctgtggtggcaactgtggttgcggaactgtcaactggaagtcctgcacatgcagctca
gggaagacagtgaagaagtatcatgaggtattgaagtttgagcctggacatttcaagaga
aggggcaaagctaagaatatggctcttgttgatatccagctggatcatcatgagcgatgt
gactgtatctgcagctcaagaccacctcgataa

KEGG   Mus musculus (mouse): 78405
Entry
78405             CDS       T01002                                 

Gene name
Ntf5, 2900040K06Rik, AI462899, NT, NT-, NT-4, NT-5, NT4, NT4/, NT4/5, Ntf, Ntf-, Ntf-5, Ntf4
Definition
(RefSeq) neurotrophin 5
  KO
K12457  neurotrophin 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04722  Neurotrophin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    78405 (Ntf5)
   04014 Ras signaling pathway
    78405 (Ntf5)
   04151 PI3K-Akt signaling pathway
    78405 (Ntf5)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    78405 (Ntf5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    78405 (Ntf5)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   78405 (Ntf5)
SSDB
Motif
Pfam: NGF Spaetzle
Other DBs
NCBI-GeneID: 78405
NCBI-ProteinID: NP_937833
MGI: 97381
Ensembl: ENSMUSG00000074121
Vega: OTTMUSG00000059407
UniProt: Q80VU4
Position
7 B3; 7 29.3 cM
AA seq 209 aa
MLPRHSCSLLLFLFLLPSVPMEPHPPSSTLPPFLAPEWDLLSPRVALSRGAPAGPPLLFL
LEAGAYGEPAGAPANRSRRGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVL
GEVPAAGGSPLRQYFFETRCKAESAGEGGPGVGGGGCRGVDRRHWLSECKAKQSYVRALT
ADSQGRVGWRWIRIDTACVCTLLSRTGRA
NT seq 630 nt   +upstreamnt  +downstreamnt
atgctccctcgccactcctgttctctcctccttttcctcttcctcctccccagcgtcccc
atggagccccaccccccatcctccaccctgcccccatttctggcccctgagtgggacctc
ttgtctccccgagtggccctgtcaaggggcgcccctgccgggccccctctcctcttcctg
ctggaggccggggcctatggagagccggcaggggccccagccaaccgcagccggcgcggg
gtgagtgagaccgcacccgcaagccgccggggtgagctggcagtatgcgacgcagtgagt
ggctgggtgaccgaccggcggacagctgtggacttgcgtgggcgcgaggtggaggtgctg
ggcgaggtgcctgcggcaggtggcagtcccctgcgtcagtacttcttcgagacgcgctgc
aaggccgaaagcgctggggaaggtggcccaggtgtgggcggagggggttgtcgcggcgtg
gatcggaggcactggctctcagaatgcaaggctaagcagtcctatgtgcgggcgttgact
gcagactcccagggccgcgtaggctggcgctggattcggatcgacacagcttgcgtctgc
acgctcctcagccgaacaggccgagcctga

KEGG   Mus musculus (mouse): 80857
Entry
80857             CDS       T01002                                 

Gene name
Fgf20
Definition
(RefSeq) fibroblast growth factor 20
  KO
K04358  fibroblast growth factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    80857 (Fgf20)
   04014 Ras signaling pathway
    80857 (Fgf20)
   04015 Rap1 signaling pathway
    80857 (Fgf20)
   04020 Calcium signaling pathway
    80857 (Fgf20)
   04151 PI3K-Akt signaling pathway
    80857 (Fgf20)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    80857 (Fgf20)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    80857 (Fgf20)
  09162 Cancer: specific types
   05226 Gastric cancer
    80857 (Fgf20)
   05218 Melanoma
    80857 (Fgf20)
   05224 Breast cancer
    80857 (Fgf20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    80857 (Fgf20)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    80857 (Fgf20)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   80857 (Fgf20)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   80857 (Fgf20)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 80857
NCBI-ProteinID: NP_085113
MGI: 1891346
Ensembl: ENSMUSG00000031603
Vega: OTTMUSG00000031718
UniProt: Q9ESL9
Position
8; 8 A4
AA seq 211 aa
MAPLTEVGAFLGGLEGLSQQVGSHFLLPPAGERPPLLGERRGALERGARGGPGSVELAHL
HGILRRRQLYCRTGFHLQILPDGTVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLG
MNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGAR
SKRHQKFTHFLPRPVDPERVPELYKDLLMYT
NT seq 636 nt   +upstreamnt  +downstreamnt
atggctcccttgaccgaagtcggggctttcttgggcggcctggagggcttgagccagcag
gtggggtcgcacttcttgctgcctcctgcaggggagaggccaccgctgttaggggagcgg
cggggcgcgttggagaggggcgcccgcggcgggcccggttccgtggagctggcgcacctg
cacggcatcctgcgccgccggcagctctactgccgcaccggcttccacctgcagatcctg
cccgacggcaccgtgcagggcacccggcaggatcacagtctcttcggtatcctggaattc
atcagtgtggcagtgggactggtcagtatcagaggtgtggacagtggcctgtaccttggg
atgaatgacaaaggagaactttatggatcagagaaattgacttctgaatgcatcttcagg
gaacaatttgaagagaactggtataatacctattcgtccaacatatataaacatggagac
acgggtcgcaggtattttgtagcacttaacaaggatggaactccaagagatggtgccagg
tccaaaagacatcaaaagtttacccactttttaccaagaccagtagacccagaaagagtt
ccagaattatacaaagacctactgatgtacacttga

KEGG   Mus musculus (mouse): 80903
Entry
80903             CDS       T01002                                 

Gene name
Fgf16
Definition
(RefSeq) fibroblast growth factor 16
  KO
K04358  fibroblast growth factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05218  Melanoma
mmu05224  Breast cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    80903 (Fgf16)
   04014 Ras signaling pathway
    80903 (Fgf16)
   04015 Rap1 signaling pathway
    80903 (Fgf16)
   04020 Calcium signaling pathway
    80903 (Fgf16)
   04151 PI3K-Akt signaling pathway
    80903 (Fgf16)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    80903 (Fgf16)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    80903 (Fgf16)
  09162 Cancer: specific types
   05226 Gastric cancer
    80903 (Fgf16)
   05218 Melanoma
    80903 (Fgf16)
   05224 Breast cancer
    80903 (Fgf16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    80903 (Fgf16)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    80903 (Fgf16)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   80903 (Fgf16)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   80903 (Fgf16)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 80903
NCBI-ProteinID: NP_085117
MGI: 1931627
Ensembl: ENSMUSG00000031230
Vega: OTTMUSG00000018263
UniProt: Q9ESL8
Position
X; X D
AA seq 207 aa
MAEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGIL
RRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNER
GELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRH
QKFTHFLPRPVDPSKLPSMSRDLFRYR
NT seq 624 nt   +upstreamnt  +downstreamnt
atggcggaggtcgggggcgtctttgcctccttggactgggacctgcacggcttctcctcc
tctctggggaacgtgcccttagctgactccccgggtttcctgaacgagcgcctgggccag
atcgaggggaagctgcagcgcggctcgcccacagacttcgcccacctgaaggggatcctg
cggcgccgccagctctactgccgcaccggcttccaccttgagatcttccccaacggcacg
gtgcacggcacccgccacgaccacagccgcttcggaattctggaatttatcagcttggct
gtggggctgatcagcatcaggggagtggactctggcctgtacctaggaatgaatgagcga
ggagagctctatggatcgaagaaactcacacgtgaatgtgttttccgggaacagtttgaa
gaaaactggtacaacacctatgcctccaccttgtacaaacactcggactcggagagacag
tattatgtggccctgaataaagacggctcaccccgggagggatacaggactaaacgacac
cagaaattcactcactttttaccaaggccagtagatccttctaagttgccctccatgtcc
agagatctcttccgctataggtaa

DBGET integrated database retrieval system