KEGG   Mus musculus (mouse): 11603
Entry
11603             CDS       T01002                                 

Gene name
Agrn, A, Agrin, NMF38, nmf380
Definition
(RefSeq) agrin
  KO
K06254  agrin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    11603 (Agrn)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:mmu00535]
    11603 (Agrn)
Proteoglycans [BR:mmu00535]
 Extracellular matrix (ECM) proteoglycans
  Basement membrane proteoglycans
   11603 (Agrn)
SSDB
Motif
Pfam: Laminin_G_1 Kazal_2 Laminin_G_2 Kazal_1 Laminin_EGF SEA EGF Laminin_G_3
Other DBs
NCBI-GeneID: 11603
NCBI-ProteinID: NP_001355955
MGI: 87961
Ensembl: ENSMUSG00000041936
Vega: OTTMUSG00000011080
Structure
PDB: 
3PVE

Position
4 E2; 4 88.55 cM
AA seq 1950 aa
MPPLPLEHRPRQQPGASVLVRYFMIPCNICLILLATSTLGFAVLLFLSNYKPGIHFTAAP
SMPPDVCRGMLCGFGAVCEPSVEDPGRASCVCKKNVCPAMVAPVCGSDASTYSNECELQR
AQCNQQRRIRLLRQGPCGSRDPCANVTCSFGSTCVPSADGQTASCLCPTTCFGAPDGTVC
GSDGVDYPSECQLLRHACANQEHIFKKFDGPCDPCQGSMSDLNHICRVNPRTRHPEMLLR
PENCPAQHTPICGDDGVTYENDCVMSRIGAARGLLLQKVRSGQCQTRDQCPETCQFNSVC
LSRRGRPHCSCDRVTCDGAYRPVCAQDGHTYDNDCWRQQAECRQQQTIPPKHQGPCDQTP
SPCRGAQCAFGATCTVKNGKAVCECQRVCSGGYDPVCGSDGVTYGSVCELESMACTLGRE
IRVARRGPCDRCGQCRFGSLCEVETGRCVCPSECVESAQPVCGSDGHTYASECELHVHAC
THQISLYVASAGHCQTCGETVCTFGAVCSAGQCVCPRCEHPPPGPVCGSDGVTYLSACEL
REAACQQQVQIEEARAGPCEPAECGSGGSGSGEDNACEQELCRQHGGVWDEDSEDGPCVC
DFSCQSVLKSPVCGSDGVTYSTECHLKKARCEARQELYVAAQGACRGPTLAPLLPMASPH
CAQTPYGCCQDNVTAAQGVGLAGCPSTCHCNPHGSYSGTCDPVTGQCSCRPGVGGLRCDR
CEPGFWNFRGIVTDGHSGCTPCSCDPRGAVRDDCEQMTGLCSCRPGVAGPKCGQCPDGQA
LGHLGCEADPTTPVTCVEMHCEFGASCVEEAGFAQCVCPTLTCPEANSTKVCGSDGVTYG
NECQLKTIACRQRLDISIQSLGPCRESVAPGVSPTSASMTTPRHILSRTLASPHSSLPLS
PSTTAHDWPTPLPTSPQTVVGTPRSTAATPSDVASLATAIFRESGSTNGSGDEELSGDEE
ASGGGSGGLEPPVGSVVVTHGPPIERASCYNSPLGCCSDGKTPSLDSEGSNCPATKAFQG
VLELEGVEGQELFYTPEMADPKSELFGETARSIESTLDDLFRNSDVKKDFWSIRLRELGP
GKLVRAIVDVHFDPTTAFQAPDVGQALLQQIQVSRPWALAVRRPLREHVRFLDFDWFPTF
FTGAATGTTAAVATARATTVSRLSASSVTPRVYPSYTSRPVGRTTAPLTTRRPPTTTASI
DRPRTPGPQRPPKSCDSQPCLHGGTCQDLDSGKGFSCSCTAGRAGTVCEKVQLPSVPAFK
GHSFLAFPTLRAYHTLRLALEFRALETEGLLLYNGNARGKDFLALALLDGHVQFRFDTGS
GPAVLTSLVPVEPGRWHRLELSRHWRQGTLSVDGEAPVVGESPSGTDGLNLDTKLYVGGL
PEEQVATVLDRTSVGIGLKGCIRMLDINNQQLELSDWQRAVVQSSGVGECGDHPCSPNPC
HGGALCQALEAGVFLCQCPPGRFGPTCADEKNPCQPNPCHGSAPCHVLSRGGAKCACPLG
RSGSFCETVLENAGSRPFLADFNGFSYLELKGLHTFERDLGEKMALEMVFLARGPSGLLL
YNGQKTDGKGDFVSLALHNRHLEFRYDLGKGAAIIRSKEPIALGTWVRVFLERNGRKGAL
QVGDGPRVLGESPKSRKVPHTMLNLKEPLYVGGAPDFSKLARGAAVASGFDGAIQLVSLR
GHQLLTQEHVLRAVDVAPFAGHPCTQAVDNPCLNGGSCIPREATYECLCPGGFSGLHCEK
GIVEKSVGDLETLAFDGRTYIEYLNAVTESELTNEIPAPETLDSRALFSEKALQSNHFEL
SLRTEATQGLVLWIGKVGERADYMALAIVDGHLQLSYDLGSQPVVLRSTVKVNTNRWLRV
RAHREHREGSLQVGNEAPVTGSSPLGATQLDTDGALWLGGLQKLPVGQALPKAYGTGFVG
CLRDVVVGHRQLHLLEDAVTKPELRPCPTL
NT seq 5853 nt   +upstreamnt  +downstreamnt
atgcctcctctgccactggaacacagacccaggcagcagcctggtgcctccgtgctggtt
cggtacttcatgatcccctgcaacatctgcttgatcctcttggctacttctacgttgggc
tttgcggtgctgcttttcctcagcaactacaaacctgggatccacttcacagcagcgcct
tctatgcctcctgatgtgtgcaggggaatgttatgtggctttggtgctgtgtgtgaacct
agtgttgaggatccaggccgggcctcctgtgtgtgcaagaagaatgtctgccctgctatg
gtagctcctgtgtgtggctcagatgcttccacctatagcaacgagtgtgagctacagcgt
gcacagtgcaaccagcaacggcgcatccgcctactccgccaagggccatgtgggtcccgg
gacccctgtgccaatgtgacctgcagtttcggtagtacctgtgtaccttcagccgatgga
cagaccgcctcgtgtctgtgtcctacaacctgctttggggcccctgatggcacagtgtgt
ggcagtgatggtgttgactaccctagtgagtgccagctgctccgtcatgcctgtgccaac
caggagcacatctttaagaagttcgatggtccttgtgacccctgccagggcagcatgtca
gacctgaatcatatttgccgggtgaacccacgtacacggcacccagaaatgcttctgcgg
cctgagaactgccccgcccaacacacacctatctgtggagatgatggggtcacctatgaa
aacgactgtgtcatgagccgtataggtgcagcccgtggcctgcttctccagaaagtgcgc
tctggtcaatgccagactcgagaccagtgcccggagacctgccagtttaactctgtatgc
ctgtcccgccgcggccgtccccactgttcctgcgatcgcgtcacctgtgatggggcttac
aggccagtgtgtgcccaggatgggcacacgtatgacaatgactgttggcgccaacaggcc
gagtgtcgacaacagcagaccattccccccaagcaccagggcccgtgtgaccagacccca
tccccgtgccgtggagcgcagtgtgcatttggggcaacatgcacagtgaagaatgggaaa
gctgtgtgcgagtgccagcgggtgtgctcgggcggctacgatcctgtgtgcggcagtgat
ggtgtcacttacggcagtgtgtgcgagctggaatccatggcctgtacccttgggcgggaa
atccgagtggcccgcagaggaccgtgtgaccgatgtgggcagtgccggtttggatccttg
tgcgaggtggagactggacgctgtgtgtgcccctctgagtgtgtggagtcagcccagccc
gtatgtggctctgacggacacacatatgctagtgaatgtgagctgcatgtccacgcctgt
acacaccagatcagcctatacgtggcctcagccggacactgccagacctgtggagaaaca
gtttgtacctttggggctgtgtgctcagctggacagtgtgtatgtccccgttgtgagcac
cccccacctggccctgtgtgcggcagtgatggcgtcacctacctcagtgcctgtgagctc
cgagaggctgcctgtcagcagcaggtacaaattgaggaggcccgtgcagggccgtgtgag
ccggctgagtgtggctcagggggctctgggtctggggaagacaatgcgtgtgagcaggag
ctgtgtcggcagcatggtggtgtctgggatgaggactcagaagacgggccgtgtgtctgt
gactttagttgccagagtgtccttaaaagcccagtgtgtggctcagatggagtcacctat
agcacggagtgccatctgaagaaggccagatgtgaagcgcggcaagagctgtacgtcgct
gctcagggagcctgccggggccctaccttggctccactgctacctatggcctccccacac
tgtgcccaaaccccctatggctgctgccaggacaatgtcactgctgcccagggtgtgggc
ttggctggctgtcccagcacctgccattgcaacccacacggctcctatagcggcacttgt
gacccagtcacagggcagtgctcctgccgaccaggtgtaggaggcctcaggtgtgatcgc
tgtgagcctggcttctggaacttccgtggcattgtcaccgatggacatagtggttgcact
ccctgcagctgtgaccctcggggtgctgtaagagatgactgtgagcagatgactggattg
tgttcctgtagacctggtgtggctggtcccaagtgtgggcagtgtccagatggtcaagcc
ctgggccatcttggctgtgaagcagatcccacaacaccagtgacttgtgtggaaatgcac
tgtgagtttggcgcctcctgcgtagaggaggctggttttgcccagtgtgtctgcccaact
ctcacatgtccagaggctaactctaccaaggtctgtggatcagatggtgtcacatacggc
aatgaatgccagctgaagaccattgcctgccgccagcgtctggacatctccattcagagt
cttggtccatgccgggagagtgttgctcctggggtttcccctacatctgcatctatgacc
accccaaggcatatcctgagcaggacactggcgtctccccacagcagccttcctctgtct
cccagcactactgcccatgattggcccaccccattacccacatcacctcagaccgtagtc
ggcacccccaggagcactgcagccacaccctctgatgtggccagtcttgctacagcgatc
ttcagggaatctggcagcaccaacggcagtggcgatgaggagctcagtggcgatgaggag
gccagtgggggcgggtctgggggacttgagcccccggtgggcagcgttgtggtgacccac
gggccacccatcgagagggcttcctgttacaactcacctttgggctgctgctcagatggc
aagacaccctcactggactcagaaggctccaactgtccagctaccaaggcattccagggc
gtgctggagcttgagggggtcgagggacaggaactgttctacacaccagagatggctgac
cccaagtcagagttgtttggggagactgcaaggagcattgagagcacgctggacgacctg
ttccggaattcggatgttaagaaggacttctggagcatccgcctacgggaactggggcct
ggcaaattagtccgtgccattgtggatgttcactttgaccccaccacagccttccaggca
ccagatgtgggtcaggccttgctccaacagatccaggtatccaggccgtgggccctggca
gtgaggaggcctctgcgggagcatgtgcgattcttggactttgactggtttcccactttt
tttacgggagctgcaacaggaaccacagctgctgtggccacagccagagccaccactgtg
agccgactgtctgcctcttctgtcaccccacgagtctaccccagttacaccagccggcct
gttggcagaactacggcaccgctaaccactcgccggccaccaaccactaccgccagtatt
gaccgacctcggactccaggcccgcaacggcccccaaagtcctgtgattcccagccttgc
ctccacggaggtacctgccaggacctggattctggcaagggtttcagctgcagctgtact
gcaggcagggctggcactgtctgtgagaaagtgcagctcccctctgtgccagcttttaag
ggccactccttcttggccttccccaccctccgagcctaccacacgctgcgtctggcacta
gaattccgggcgctggagacagagggactgctgctctacaatggcaatgcacgtggcaaa
gatttcctggctctggctctgttggatggtcatgtacagttcaggttcgacacgggctca
gggccggcggtgctaacaagcttagtgccagtggaaccgggacggtggcaccgcctcgag
ttgtcacggcattggcggcagggcacactttctgtggatggcgaggctcctgttgtaggt
gaaagtccgagtggcactgatggcctcaacttggacacgaagctctatgtgggtggtctc
ccagaagaacaagttgccacggtgcttgatcggacctctgtgggcatcggcctgaaagga
tgcattcgtatgttggacatcaacaaccagcagctggagctgagcgattggcagagggct
gtggttcaaagctctggtgtgggggaatgcggagaccatccctgctcacctaacccctgc
catggcggggccctctgccaggccctggaggctggcgtgttcctctgtcagtgcccacct
ggccgctttggcccaacttgtgcagatgaaaagaacccctgccaaccgaacccctgccac
gggtcagccccctgccatgtgctttccaggggtggggccaagtgtgcgtgccccctggga
cgcagtggttccttctgtgagacagtcctggagaatgctggctcccggcccttcctggct
gactttaatggcttctcctacctggaactgaaaggcttgcacaccttcgagagagaccta
ggggagaagatggcgctggagatggtgttcttggctcgtgggcccagtggcttactcctc
tacaatgggcagaagacggatggcaagggggactttgtatccctggccctgcataaccgg
cacctagagttccgctatgaccttggcaagggggctgcaatcatcaggagcaaagagccc
atagccctgggcacctgggttagggtattcctggaacgaaatggccgcaagggtgccctt
caagtgggtgatgggccccgtgtgctaggggaatctccgaaatcccgcaaggtcccgcac
accatgctcaacctcaaggagcccctctatgtggggggagctcctgacttcagcaagctg
gctcggggcgctgcagtggcctccggctttgatggtgccatccagctggtgtctctaaga
ggccatcagctgctgactcaggagcatgtgttgcgggcagtagatgtagcgccttttgca
ggccacccttgtacccaggccgtggacaacccctgccttaatgggggctcctgtatcccg
agggaagccacttatgagtgcctgtgtcctgggggcttctctgggctgcactgcgagaag
gggatagttgagaagtcagtgggggacctagaaacactggcctttgatgggcggacctac
atcgagtacctcaatgctgtgactgagagcgagctgaccaatgagatcccagcccccgaa
actctggattcccgggcccttttcagtgagaaagcgctgcagagcaaccactttgagctg
agcttacgcactgaggccacgcaggggctggtgctgtggattggaaaggttggagaacgt
gcagactacatggctctggccattgtggatgggcacctacaactgagctatgacctaggc
tcccagccagttgtgctgcgctccactgtgaaggtcaacaccaaccgctggcttcgagtc
agggctcacagggagcacagggaaggttcccttcaggtgggcaatgaagcccctgtgact
ggctcttccccgctgggtgccacacaattggacacagatggagccctgtggcttggaggc
ctacagaagcttcctgtggggcaggctctccccaaggcctatggcacgggttttgtgggc
tgtctgcgggacgtggtagtgggccatcgccagctgcatctgctggaggacgctgtcacc
aaaccagagctaagaccctgccccactctctga

DBGET integrated database retrieval system