KEGG   Mus musculus (mouse): 11605
Entry
11605             CDS       T01002                                 

Symbol
Gla, Ags
Name
(RefSeq) galactosidase, alpha
  KO
K01189  alpha-galactosidase [EC:3.2.1.22]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00052  Galactose metabolism
mmu00561  Glycerolipid metabolism
mmu00600  Sphingolipid metabolism
mmu00603  Glycosphingolipid biosynthesis - globo and isoglobo series
mmu01100  Metabolic pathways
mmu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    11605 (Gla)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    11605 (Gla)
   00600 Sphingolipid metabolism
    11605 (Gla)
  09107 Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    11605 (Gla)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    11605 (Gla)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     11605 (Gla)
SSDB
Motif
Pfam: Melibiase_2 Melibiase_2_C Melibiase Melibiase_C Chromo
Other DBs
NCBI-GeneID: 11605
NCBI-ProteinID: NP_038491
MGI: 1347344
Ensembl: ENSMUSG00000031266
Vega: OTTMUSG00000019384
UniProt: Q8BGZ6 Q3UM38
Position
X:complement(133488918..133501875)
AA seq 421 aa
MAMKLLSRDTRLVCELALCPLALVFWSILGVRALDNGLARTPTMGWLHWERFMCNLDCQE
EPDACISEQLFMQMAELMVSDGWRDAGYDYLCIDDCWMAPERDSKGRLQADPQRFPSGIK
HLANYVHSKGLKLGIYADVGNKTCAGFPGSFGSYDIDAQTFADWGVDLLKFDGCHCDSVV
SLENGYKYMALALNRTGRSIVYSCEWPLYLRPFHKPNYTDIQYYCNHWRNFDDVYDSWES
IKNILSWTVVYQKEIVEVAGPGSWNDPDMLVIGNFGLSWDQQVTQMALWAIMAAPLLMSN
DLRQISSQAKALLQNKDVIAINQDPLGKQGYCFRKENHIEVWERPLSNLAWAVAVRNLQE
IGGPCPYTIQISSLGRGLACNPGCIITQLLPEKVHLGFYEWTLTLKTRVNPSGTVLFRLE
R
NT seq 1266 nt   +upstreamnt  +downstreamnt
atggccatgaagcttttgagcagagatacgcggctggtctgtgagcttgcgctttgtccc
ctggctttagttttctggagcattcttggggtcagagcattggacaatggcttggcgcgg
actcctactatgggctggctgcattgggaacgtttcatgtgcaaccttgactgccaagaa
gagcctgatgcctgcataagtgagcaactgttcatgcagatggcagagctcatggtctct
gatggctggcgggatgcaggttatgactatctctgcatagatgactgttggatggctccc
gagagggattcaaagggcaggcttcaggcagatccccaacgctttcctagtgggatcaaa
cacctcgcaaattacgtccacagcaaaggattgaagctagggatttatgcagatgttggg
aataaaacctgtgcaggtttccccgggagttttggatcctatgacattgatgcgcagaca
tttgctgactggggcgtagatctgctaaaatttgatggttgtcactgtgacagtgtagta
tccttggagaatggttataagtacatggccttggccttgaacaggacaggccgaagcatt
gtatactcctgtgagtggccactttatttgagaccctttcataagcccaattatacagat
atccaatattactgcaatcattggagaaattttgatgatgtttatgattcctgggaaagc
ataaagaatatcttgtcttggacagtggtttaccagaaggagattgttgaagtcgctgga
ccaggcagctggaatgacccagacatgttagtgatcggcaactttggcctcagttgggac
cagcaggtgacacagatggccctctgggctatcatggccgctcccctactcatgtccaac
gatctgcgacaaatcagctctcaagccaaagctctgcttcagaataaggatgtaattgcc
atcaaccaagaccccttgggcaagcagggctactgtttcagaaaggaaaaccacattgag
gtttgggaacggccactctccaacctagcctgggctgtggctgtgagaaacctgcaggag
attggtggaccttgtccttataccatccagatttcttccctgggtagaggactagcctgc
aatcctggctgcatcattactcagcttctccccgagaaagtacacctaggcttctatgaa
tggactttgaccttaaaaactcgagtaaacccctcaggcactgttttgtttcggttagaa
agataa

DBGET integrated database retrieval system