KEGG   Mus musculus (mouse): 11607Help
Entry
11607             CDS       T01002                                 

Gene name
Agtr1a, 1810074K20Rik, AG2S, AI551199, AT1, AT1a, AT2R1, AT2R1A, Agtr-1a, Agtr1, Angtr-1a
Definition
(RefSeq) angiotensin II receptor, type 1a
  KO
K04166  angiotensin II receptor type 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04270  Vascular smooth muscle contraction
mmu04371  Apelin signaling pathway
mmu04614  Renin-angiotensin system
mmu04924  Renin secretion
mmu04925  Aldosterone synthesis and secretion
mmu04927  Cortisol synthesis and secretion
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04934  Cushing syndrome
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    11607 (Agtr1a)
   04020 Calcium signaling pathway
    11607 (Agtr1a)
   04072 Phospholipase D signaling pathway
    11607 (Agtr1a)
   04022 cGMP-PKG signaling pathway
    11607 (Agtr1a)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    11607 (Agtr1a)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    11607 (Agtr1a)
   04614 Renin-angiotensin system
    11607 (Agtr1a)
   04925 Aldosterone synthesis and secretion
    11607 (Agtr1a)
   04927 Cortisol synthesis and secretion
    11607 (Agtr1a)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    11607 (Agtr1a)
   04270 Vascular smooth muscle contraction
    11607 (Agtr1a)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    11607 (Agtr1a)
  09167 Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    11607 (Agtr1a)
   04934 Cushing syndrome
    11607 (Agtr1a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    11607 (Agtr1a)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    11607 (Agtr1a)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    11607 (Agtr1a)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Peptide
   Angiotensin
    11607 (Agtr1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 11607
NCBI-ProteinID: NP_796296
MGI: 87964
Ensembl: ENSMUSG00000049115
Vega: OTTMUSG00000000668
UniProt: P29754
Position
13 A3.2; 13 13.19 cM
AA seq 359 aa AA seqDB search
MALNSSTEDGIKRIQDDCPRAGRHSYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLK
TVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNHLCKIASASVSFNLYASVFLLT
CLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLMAGLASLPAVIHRNVYFIENTNITVC
AFHYESRNSTLPIGLGLTKNILGFLFPFLIILTSYTLIWKALKKAYEIQKNKPRNDDIFR
IIMAIVLFFFFSWVPHQIFTFLDVLIQLGVIHDCKIADIVDTAMPITICIAYFNNCLNPL
FYGFLGKKFKKYFLQLLKYIPPKAKSHSSLSTKMSTLSYRPSDNMSSAAKKPASCSEVE
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggcccttaactcttctactgaagatggcatcaaaagaattcaagatgactgccccagg
gctggcaggcacagttacatatttgtcatgatccctactctctacagcatcatctttgtg
gtgggaatatttggaaacagcttggtggtgatcgtcatctacttttacatgaagctgaag
actgtggccagtgtctttcttctaaatctcgccctggctgacttatgctttttgctgact
ttgcccctgtgggctgtctataccgctatggaataccgctggcccttcggcaatcaccta
tgtaagatcgcttcggccagcgtcagtttcaacctctacgccagcgtgttcctgctcacg
tgtctcagcatcgatcgctacctggccattgtccacccgatgaagtctcgcctccgccgc
acgatgctggtggccaaagtcacctgcatcatcatctggctgatggctggcttggccagt
ttgccagccgtcatccaccgaaatgtgtatttcattgagaacaccaatatcactgtttgc
gcttttcattacgagtcccggaattcaacgctccccataggactgggcctaaccaagaac
atcctgggcttcctgttccctttcctaatcattcttaccagctatactcttatatggaaa
gctctaaagaaggcttatgaaattcagaagaacaagccaagaaatgatgacatctttagg
ataattatggcgattgtgcttttcttcttcttctcctgggtcccccaccaaatattcaca
ttcctggatgtgctgattcagctgggcgtcatccatgactgtaaaattgccgacatcgtg
gacactgccatgcccataaccatctgcatagcgtattttaacaactgcctgaaccctctg
ttttacggctttctggggaaaaaatttaaaaagtatttcctccagctcctgaaatatatt
cccccaaaggccaagtcgcactcaagcctgtctacgaaaatgagcacgctctcctaccgc
ccctcagataacatgagctcagccgccaaaaagcctgcgtcttgttctgaggtggagtga

DBGET integrated database retrieval system