KEGG   Mus musculus (mouse): 11609
Entry
11609             CDS       T01002                                 

Gene name
Agtr2, AI316812, AW107640
Definition
(RefSeq) angiotensin II receptor, type 2
  KO
K04167  angiotensin II receptor type 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04614  Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    11609 (Agtr2)
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    11609 (Agtr2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    11609 (Agtr2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    11609 (Agtr2)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Peptide
   Angiotensin
    11609 (Agtr2)
SSDB
Motif
Pfam: 7tm_1 FA_desaturase
Other DBs
NCBI-GeneID: 11609
NCBI-ProteinID: NP_031455
MGI: 87966
Ensembl: ENSMUSG00000068122
Vega: OTTMUSG00000017210
UniProt: P35374 Q3US12
Position
X A2; X 16.71 cM
AA seq 363 aa
MKDNFSFAATSRNITSSRPFDNLNATGTNESAFNCSHKPSDKHLEAIPVLYYMIFVIGFA
VNIVVVSLFCCQKGPKKVSSIYIFNLALADLLLLATLPLWATYYSYRYDWLFGPVMCKVF
GSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYVVPLVWCMACLSSLPTFY
FRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLK
TNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALTWMGIINSCEVIAVIDLAL
PFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKGSSLREMDT
FVS
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgaaggacaacttcagttttgctgccaccagcagaaacattaccagcagccgtcctttt
gataatctcaacgcaactggcaccaatgagtccgcctttaattgctcacacaaaccatca
gataagcatttggaagcaattcctgttctctactacatgatttttgtgattgggtttgct
gttaatattgttgtggtctcactgttttgttgtcaaaagggccctaaaaaggtgtccagc
atttacatcttcaatctggccttggctgacttactccttttggctaccctccctctctgg
gcaacctattactcttatagatatgattggctttttggacctgtgatgtgcaaagtgttt
ggttcttttctgactctgaacatgtttgcaagcattttttttattacctgcatgagtgtc
gataggtaccaatcggtcatctacccttttctgtctcaaagaaggaatccctggcaagca
tcttatgtagttccccttgtttggtgtatggcttgtctatcctcattgccaacattttat
ttccgggatgtcagaaccattgaatacttaggtgtgaatgcttgtattatggctttccca
cccgagaaatatgctcagtggtctgctgggattgccttaatgaaaaatattcttggcttt
attattcctttaatattcatagcaacgtgttactttggaatcagaaaacatctgctgaag
actaatagctatgggaagaacagaattacccgtgaccaagtcctgaagatggcagctgct
gttgtgttggcattcatcatttgctggcttcccttccatgttctgaccttcttggatgct
ctgacctggatgggtatcattaatagctgtgaagttatagcagtcattgacctggcactt
ccttttgccatcctcctgggattcaccaacagctgtgttaatcccttcctgtattgtttt
gttggaaaccgcttccaacagaagctccgcagtgtgtttagagttcccattacttggctc
caaggcaagagagagactatgtcttgcagaaaaggcagttctcttagagaaatggacacc
tttgtgtcttaa

DBGET integrated database retrieval system