KEGG   Mus musculus (mouse): 11610Help
Entry
11610             CDS       T01002                                 

Gene name
Agtrap, 3300002E14Rik, AT1R, Atrap, D4Wsu124e
Definition
(RefSeq) angiotensin II, type I receptor-associated protein
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: AGTRAP
Motif
Other DBs
NCBI-GeneID: 11610
NCBI-ProteinID: NP_033772
MGI: 1339977
Ensembl: ENSMUSG00000029007
Vega: OTTMUSG00000010935
UniProt: Q9WVK0
Position
4 E2; 4 78.67 cM
AA seq 161 aa AA seqDB search
MELPAVNLKVILLVHWLLTTWGCLVFSSSYAWGNFTILALGVWAVAQRDSIDAIGMFLGG
LVATIFLDIIYISIFYSSVATGDTGRFGAGMAILSLLLKPFSCCLVYHMHRERGGELPLR
PDFFGPSQEHSAYQTIDSSSDAAADPFASLENKGQAVPRGY
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggagctgcctgccgtgaacttgaaggttattctcctggttcactggctgttgacaacc
tggggctgcttggtgttctcaagctcctatgcttggggcaacttcactatcctggccctg
ggtgtgtgggctgtggcccagcgggactctatagatgccataggcatgtttcttggtggc
ttggttgccaccatcttcctggacattatctacattagcatcttctactcgagtgttgcc
actggggacactggccgcttcggcgccggcatggccatcctcagcttgctgctgaagccc
ttctcttgctgcctcgtctaccacatgcaccgtgaacgagggggtgagctccccctccgc
cccgatttcttcggaccctctcaggagcacagtgcctaccagacaattgactcatcatca
gacgctgctgcagacccctttgcaagcctggagaacaagggccaagctgtcccccggggg
tactga

DBGET integrated database retrieval system