KEGG   Mus musculus (mouse): 11611
Entry
11611             CDS       T01002                                 

Gene name
Agxt, AGT, Agt1, Agxt1, SPT
Definition
(RefSeq) alanine-glyoxylate aminotransferase
  KO
K00830  alanine-glyoxylate transaminase / serine-glyoxylate transaminase / serine-pyruvate transaminase [EC:2.6.1.44 2.6.1.45 2.6.1.51]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00250  Alanine, aspartate and glutamate metabolism
mmu00260  Glycine, serine and threonine metabolism
mmu00630  Glyoxylate and dicarboxylate metabolism
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    11611 (Agxt)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    11611 (Agxt)
   00260 Glycine, serine and threonine metabolism
    11611 (Agxt)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    11611 (Agxt)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mmu01007]
    11611 (Agxt)
Enzymes [BR:mmu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.44  alanine---glyoxylate transaminase
     11611 (Agxt)
    2.6.1.45  serine---glyoxylate transaminase
     11611 (Agxt)
    2.6.1.51  serine---pyruvate transaminase
     11611 (Agxt)
Amino acid related enzymes [BR:mmu01007]
 Aminotransferase (transaminase)
  Class V
   11611 (Agxt)
SSDB
Motif
Pfam: Aminotran_5 Aminotran_1_2 Cys_Met_Meta_PP
Other DBs
NCBI-GeneID: 11611
NCBI-ProteinID: NP_057911
MGI: 1329033
Ensembl: ENSMUSG00000026272
Vega: OTTMUSG00000048639
UniProt: O35423 Q3UEN9
Structure
PDB: 
3KGW 3KGX

Position
1 D; 1 47.0 cM
AA seq 414 aa
MFRMLAKASVTLGSRAAGWVRTMGSYQLLVPPPEALSKPLSVPTRLLLGPGPSNLAPRVL
AAGSLRMIGHMQKEMLQIMEEIKQGIQYVFQTRNPLTLVVSGSGHCAMETALFNLLEPGD
SFLTGTNGIWGMRAAEIADRIGARVHQMIKKPGEHYTLQEVEEGLAQHKPVLLFLVHGES
STGVVQPLDGFGELCHRYQCLLLVDSVASLGGVPIYMDQQGIDIMYSSSQKVLNAPPGIS
LISFNDKAKYKVYSRKTKPVSFYTDITYLAKLWGCEGETRVIHHTTPVTSLYCLRESLAL
IAEQGLENCWRRHREATAHLHKHLQEMGLKFFVKDPEIRLPTITTVTVPAGYNWRDIVSY
VLDHFSIEISGGLGPTEERVLRIGLLGYNATTENVDRVAEALREALQHCPKNKL
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgttccggatgttggccaaggccagtgtgacgctgggctccagagcggcaggttgggtc
cggaccatgggctcgtatcagctgctggtgccaccgccagaggccctgagcaagcccctg
tcagttcctacgaggctcctgttgggtccggggccctccaacctggctccccgtgtgctg
gcggcgggaagtctgagaatgattggccacatgcaaaaagagatgcttcagatcatggag
gagatcaagcaaggcatccagtatgtgttccagaccaggaaccccctcacactggttgtc
agcggttcagggcactgcgccatggagactgccctgttcaacctcctagagcctggggac
tcctttctaaccggaaccaatggcatctggggaatgcgggctgcagagattgctgatcgc
attggagcccgtgtgcaccagatgatcaagaagcctggagaacattatacactgcaggag
gtggaggagggcctggcccaacacaaaccggtattgctgttcctggtccacggggagtca
tccactggcgtggtgcagcccctggatggttttggggagctctgccataggtaccagtgc
ctactcctggtggactcagtggcatccctgggcggggttcctatctacatggaccaacaa
ggcattgacatcatgtactctagctctcagaaggtcctgaatgccccaccagggatctcc
ctcatctccttcaacgacaaggccaaatacaaggtctactcccggaagacaaagccagtc
tccttctacacagacatcacatacttggccaaattgtggggatgtgagggcgagaccaga
gtaattcatcataccacacctgtcaccagcttatactgcctgagggagagcctggcactc
attgcagagcagggcctggagaattgctggcggcgtcacagggaggctacagcacatctg
cacaaacacctgcaggagatgggcttaaagttctttgtgaaggatccggaaatccggcta
cccacaatcaccaccgtgactgtgcctgccggctacaactggagggacatcgtcagctat
gtgctggaccacttcagcattgaaatctctgggggtcttgggcccactgaggagagggtg
ctacggattggcctcctgggctacaacgccaccactgagaatgtggaccgtgtggccgag
gccctgagggaggccctgcagcattgtcctaagaacaagttgtga

DBGET integrated database retrieval system