KEGG   Mus musculus (mouse): 11614
Entry
11614             CDS       T01002                                 

Gene name
Nr0b1, AH, AHX, Ahc, Ahch, DAX-, DAX-1, Dax, Dax1
Definition
(RefSeq) nuclear receptor subfamily 0, group B, member 1
  KO
K08562  nuclear receptor subfamily 0 group B member 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04927  Cortisol synthesis and secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    11614 (Nr0b1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    11614 (Nr0b1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mmu03310]
    11614 (Nr0b1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys4 Knirps/DAX1-like
    11614 (Nr0b1)
Nuclear receptors [BR:mmu03310]
 0. Knirps / DAX like
  0B. DAX like receptor
   11614 (Nr0b1)
SSDB
Motif
Pfam: NR_Repeat Hormone_recep
Other DBs
NCBI-GeneID: 11614
NCBI-ProteinID: NP_031456
MGI: 1352460
Ensembl: ENSMUSG00000025056
Vega: OTTMUSG00000017945
UniProt: Q61066 Q53ZY9
Structure
PDB: 
3F5C

Position
X C1; X 39.67 cM
AA seq 472 aa
MAGEDHPWQGSILYNLLMSAKQKHASQEEREVRLGAQCWGCACGAQPVLGGERLSGGQAR
SLLYRCCFCGENHPRQGGILYSMLTNARQPSVATQAPRARFGAPCWGCACGSAEPLVGRE
GLPAGQAPSLLYRCCFCGEEHPRQGSILYSLLTSAQQTHVSREAPEAHRRGEWWQLSYCT
QSVGGPEGLQSTQAMAFLYRSYVCGEEQPQQISVASGTPVSADQTPATPQEQPRAPWWDA
SPGVQRLITLKDPQVVCEAASAGLLKTLRFVKYLPCFQILPLDQQLVLVRSCWAPLLMLE
LAQDHLHFEMMEIPETNTTQEMLTTRRQETEGPEPAEPQATEQPQMVSAEAGHLLPAAAV
QAIKSFFFKCWSLNIDTKEYAYLKGTVLFNPDLPGLQCVKYIEGLQWRTQQILTEHIRMM
QREYQIRSAELNSALFLLRFINSDVVTELFFRPIIGAVSMDDMMLEMLCAKL
NT seq 1419 nt   +upstreamnt  +downstreamnt
atggcgggtgaggaccacccgtggcagggcagcatcctctacaatctactgatgagcgcg
aagcagaagcacgcgtctcaggaagagcgagaggtgcgcttgggggctcagtgctggggt
tgcgcctgcggtgctcagcccgtcctgggtggggagagactgtccggcgggcaagccagg
tccctcttgtaccgctgctgcttttgtggggagaatcacccgcgccagggtggcatcctc
tactctatgctcaccaacgccaggcagccaagcgtggcgacccaggcgccgagggcacga
ttcggagcaccttgctggggctgcgcctgcggcagcgcagagcccctggtgggcagagag
gggctgccggctggccaggccccctcgctcctgtaccgctgctgcttctgcggagaagag
cacccgaggcagggcagcatcttatacagcttgctcactagcgctcagcaaacgcacgtg
tctcgggaagcacccgaggcacatcgcagaggcgagtggtggcagctgtcctactgtacc
cagagtgtgggtggcccagaggggctgcagagcacacaggccatggcgttcctgtaccgc
agctatgtgtgcggtgaagagcagccccagcagatcagcgttgcctctggcacgcccgtg
agcgcagaccaaacaccagcgaccccgcaagagcagccgagggctccctggtgggacgcc
tcacctggtgtgcagcgtctgatcacactcaaggatccacaggtggtgtgcgaggcagcg
tccgctggcctgttgaagaccctgcgctttgtcaagtacttgccctgcttccagatcctg
cccctagatcagcagctggtgctggtgcggagctgttgggcgcccctactcatgcttgag
ttggcccaagatcacctgcacttcgagatgatggagatcccggagaccaacacgacgcag
gaaatgcttaccaccaggcggcaggagaccgaaggtccagagcctgcagagccccaggcc
acagagcagccacagatggtgtccgcggaggctgggcacttgctcccagctgctgcggtc
caggccatcaagagtttctttttcaagtgctggagtctgaacattgacaccaaagagtat
gcctatctgaaagggaccgtgctctttaacccagacctgcctggcctgcagtgcgtgaaa
tacattgagggtcttcagtggagaacccagcagatccttactgagcacatccggatgatg
cagagagagtaccagatcagatccgctgaactgaacagtgcccttttcctgctgagattc
atcaatagcgatgtcgtcactgaactctttttcaggcccatcattggtgcagtcagcatg
gatgatatgatgctggagatgctctgtgcaaagctgtga

DBGET integrated database retrieval system