KEGG   Mus musculus (mouse): 11624
Entry
11624             CDS       T01002                                 

Gene name
Ahrr, mKIAA1234
Definition
(RefSeq) aryl-hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    11624 (Ahrr)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    11624 (Ahrr)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9 PAS_4
Other DBs
NCBI-GeneID: 11624
NCBI-ProteinID: NP_033774
MGI: 1333776
Ensembl: ENSMUSG00000021575
Vega: OTTMUSG00000023058
UniProt: Q3U1U7 Q8C696 A0A0R4J020
Position
13; 13 C1
AA seq 701 aa
MMIPSGECTYAGRKRRKPIQKRRLTMGAEKSNPSKRHRDRLNTELDHLASLLPFSPDIIS
KLDKLSVLRLSVSYLRVKSFFQALQETCVWSAPALSPEEHSYRGFPVQEGRLLLESLNGF
ALVVSAEGMIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPQVVF
GQSPHADTDNTVLGKLLRAQEGGKGLPSEYSAFLTRCFICRVRCLLDSTSGFLTMQFQGK
LKFLFGQKKKTPSGTALPPRLSLFCIVAPVLPSVTEMKMKSTFLKAKHRADIVVTMDSRA
KAVTSLCESELHPKLNYLAGKSNGENGISLFRGQTDRSHWARALARSSCLCLRGGPDLLD
PKGTSGDREEEDQKHILRRSPGAWGQREMHKYSYGLETPVHLRHLNWSTEQRSQESTTKL
TRQPSKNEPSTCLVPHGSCVPYPGSQGMLSASNMASFRDSLDHPTGAYCSQMNRPLSDIH
QGQVDPSTCHISQGSLGSRIPLTGMQRFTARGFSTEDAKLPSLPVTIGTPCNPVLSLDVP
IKMENESGSQDIVEASTTSCLWLGTSDMARGHLVGFPARMHLKTEPDYRQQACTPHLGHG
MLGTNPYSRDTVGSCREHAPLYSAHCTCLDPEPPHHFFMCSHSESQHPSLDQDCRAPIVK
REPLDSPSWAAPGQVTVPRMFPKSASKTVIPSKGSDGIFLP
NT seq 2106 nt   +upstreamnt  +downstreamnt
atgatgattccgtctggagagtgtacatacgccggtaggaagagaaggaagcccattcag
aagcggaggcttaccatgggagctgagaaatcaaatccttccaaacggcaccgggaccgc
ctcaatacagagctggaccacctggccagcctgctgccattttcacctgatatcatctcc
aagctggacaagctttctgtcctgcgcctcagcgttagctacctcagggtaaagagcttc
ttccaagccttgcaggagacatgtgtatggtcagctccagccctgtcacctgaagaacac
tcatacagagggttccccgtgcaggaaggacggctgctgctggagtctctcaatggcttc
gctctggtggtgagtgccgaagggatgatcttttatgcatcggcaacaattgtggactat
ctgggctttcatcagacagatgtcatgcatcaaaacatttatgactacatccatgtggat
gaccggcaggacttctgcagacagctacactgggccatggaccctcctcaggtggtgttt
gggcagtccccacatgctgacacagacaatactgtcctggggaagctgctcagggcccaa
gaaggaggcaagggcttgccctcagagtactcggccttcttgacacgctgcttcatttgt
cgtgttcgctgcctgctggacagcacctctggctttctgaccatgcagttccaaggaaaa
ctaaaattcctgtttggacagaagaagaagacaccatcaggaacagccctgcctcctcga
ctctcattgttctgcattgtggcaccagtcttgccttctgtaactgagatgaaaatgaaa
agcacattcttgaaggcaaagcacagggcagacattgtggttacgatggactcaagggca
aaagctgttacaagtctatgtgaatcagaattgcatcccaaactcaattacttagcagga
aagagcaatggagaaaatggcatttcactgttcaggggacaaacagataggagccactgg
gcccgggctctagccagatcttcatgtctgtgcctcaggggtggtcctgacctgctggac
cccaaggggacttcaggggacagagaagaggaggaccagaagcacatactaaggagatcc
cctggtgcctgggggcagagggagatgcacaagtacagttatggtttggagacaccagta
cacttgaggcacctgaactggagcacagaacagcgaagtcaggagagcactaccaagctg
actcggcagcccagtaagaatgagccatccacgtgtctggtgccccatggttcctgtgtg
ccctaccctggaagccagggcatgcttagtgccagcaacatggcttcttttagagattca
ctagaccatcccactggtgcctactgcagtcagatgaacagacccttgtcggatatccac
cagggccaggtggatccttccacctgccatatctcccagggcagtctgggatctaggatc
cctctgactggaatgcagcgcttcacagctcggggattttctacagaggatgcaaaatta
cccagcctgccagtgaccataggcactccatgcaacccagtattgtcactggatgtgcca
atcaagatggagaatgaatctgggtcccaggatatagttgaagctagcacaactagctgt
ttgtggctgggaaccagcgacatggccagaggacatctggttggtttccctgccaggatg
cacctgaaaacagagcccgactataggcagcaggcctgtaccccacaccttggtcatggt
atgctgggaactaatccctacagcagagatactgttggatcctgtagggagcatgctcct
ctttactctgcacattgcacctgcctggatccagagcctcctcatcacttcttcatgtgt
agccacagtgagagccagcacccctcattggaccaagactgcagagctcctattgttaag
cgtgagcctctggactcaccatcatgggctgctcctggtcaggtgactgtgcccaggatg
ttccctaagagtgcctctaaaactgtgatcccatccaaaggctctgatggaattttccta
ccctag

DBGET integrated database retrieval system