KEGG   Mus musculus (mouse): 11625Help
Entry
11625             CDS       T01002                                 

Gene name
Ahsg
Definition
(RefSeq) alpha-2-HS-glycoprotein
  KO
K23409  alpha-2-HS-glycoprotein
Organism
mmu  Mus musculus (mouse)
Brite
Peptidases and inhibitors [BR:mmu01002]
 Peptidase inhibitors
  Family I25: cystatin family
   11625 (Ahsg)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cystatin Cathelicidins
Motif
Other DBs
NCBI-GeneID: 11625
NCBI-ProteinID: NP_038493
MGI: 107189
Ensembl: ENSMUSG00000022868
UniProt: P29699 Q3UEK9
Position
16 B1; 16 13.74 cM
AA seq 345 aa AA seqDB search
MKSLVLLLCFAQLWGCQSAPQGTGLGFRELACDDPEAEQVALLAVDYLNNHLLQGFKQVL
NQIDKVKVWSRRPFGVVYEMEVDTLETTCHALDPTPLANCSVRQLTEHAVEGDCDFHILK
QDGQFRVMHTQCHSTPDSAEDVRKLCPRCPLLTPFNDTNVVHTVNTALAAFNTQNNGTYF
KLVEISRAQNVPLPVSTLVEFVIAATDCTAKEVTDPAKCNLLAEKQHGFCKANLMHNLGG
EEVSVACKLFQTQPQPANANAVGPVPTANAALPADPPASVVVGPVVVPRGLSDHRTYHDL
RHAFSPVASVESASGETLHSPKVGQPGAAGPVSPMCPGRIRHFKI
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaagtccctggtcttgctcctttgttttgctcagctctggggctgccaatccgctcca
caaggtacaggactgggttttagagaattggcttgtgatgatccagaagcagagcaagta
gctttgttggccgtggactacctcaataatcatcttcttcagggattcaaacaggtcttg
aatcagatcgacaaagtcaaggtgtggtctcggcggcccttcggagtggtgtatgagatg
gaagttgacacactggagaccacttgccatgctttggaccccaccccgctggcaaactgt
tctgtgaggcagctgactgagcacgcggtggagggagactgtgacttccacatcctgaaa
caagacggccagttcagggtgatgcacacccagtgtcattccaccccagactctgcagag
gacgttcgtaagttgtgcccacggtgcccactcctgactccgttcaacgataccaacgtg
gtccacaccgtcaacactgccctggctgccttcaacacacagaataatggaacctatttt
aaactggtggagatttcccgggctcaaaatgtgcctctcccagtgtctactctggtggag
tttgtaatagctgccactgactgtactgcaaaagaagtcacagatccagccaaatgcaac
ctgctggcagagaagcaacatggcttctgcaaggcaaatctcatgcataatcttggtggg
gaagaagtttcagtggcctgcaagttattccaaacacagccccagccagccaatgccaac
gcagtaggtcccgtacccacagcgaatgcagccctaccagctgacccacctgcatctgtg
gtggtgggacctgtggtggttccacgaggactttcagaccaccgaacttaccacgaccta
cgccacgccttctctcctgtggcctcggtggagtcggcctcgggagaaactcttcattct
cctaaggtgggccagcctggtgctgctggtccagtgtcccccatgtgcccagggaggatc
agacacttcaaaatctag

DBGET integrated database retrieval system