KEGG   Mus musculus (mouse): 11630Help
Entry
11630             CDS       T01002                                 

Gene name
Crybg1, Aim1
Definition
(RefSeq) crystallin beta-gamma domain containing 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Crystall Ricin_B_lectin Inhibitor_I36
Motif
Other DBs
NCBI-GeneID: 11630
NCBI-ProteinID: NP_001355234
MGI: 109544
Ensembl: ENSMUSG00000019866
Vega: OTTMUSG00000055246
Position
10 B2; 10 23.14 cM
AA seq 2065 aa AA seqDB search
MPLSPPSQGDPREASPSKAPKKHPTFHIWRSKKKQSPSSSCGVFIPHPPGAFGETRAFLV
PDGSQGEPQELTLHGGELQLSDTPSEVPGPSSTESAMLKKSRAQPPEDTRRKPVLEKLGT
LFTAGRRRNTRNGLESPTNSNSKSASAKVPKTGSEKTKAQDNQLKATDAGEAGPRQEAEG
QPVESCVQATPCDAEQSPCSSINVGVVQQCHSNDSAQLEPLQAEGETFPDATTAAKELLH
SSPGNRSRQESAETPARSPGEEALPGAGLQPETARGVSGSPPEEHLVGGVGEAPDGAPGV
GAEAGSLGAPGDAVPPGEPPAQDAETSRTAGSVDRAHPTKVLTLDIYLSKTEVAQVDEPA
SIAPGTDDCEDSDDMEKRSSGRRSGRRRKSQKSTDSPGADAVAPESAAKDEAVFDDEVAP
DAAAENCLAERKVKSVQAVPDGGAAPVACPEPKASSCPRGQPRGEPDRSKPLSPTKRKGR
SRVPEAVPSSPGSGSRAPAKESPPKRAPAAADSGEEAGRVVPRELTVKSSSLLPEIKPEH
KRGPLPHHFDSRGDGGRSRGTGASDADGLKPRNQFGVGRSTVTTKVTLPARPKHVELNLK
TPKNPDSLGNEHNSFSQPVHKGNTANKISLFENKRANSSPRHPDVRNTRNNPPSSKTFVG
RAKLNLAKKAKEMEQPEKKAVSTSHQNGLVVKEPSAEGKGTAVPVPREEIRPATRGGEGE
STKDQVLRPEPEQSDKLDVQTDTAYPSHPGPTALVPVKDSELSGEGQPEAADSKGPVLNN
TSDVAQDIAAICDAREAPPKPQDAFSDSQPASAAESARESSLPPSAPISVDAPQDGCVQV
PICSVPCTALEVSENHNGCVSPVSPHTEKTPISKPGVGEASPPSTPEHSPETMGKDCPSK
VLVQVRSFVLPVENPQDVSSQVISESSEVREAQLPSCHSNEPEVVSVTTCVPQHEDAPDT
SPKDIHHREGHVAQSRPHITQSGPEKAPPIQSSSGMPQTAEFILTHSPSSRSHAEGPQRP
GQDATSPLTPTRLLNISAGSDNSVLDSSSDMEKFTEIIKKMDSAVCVPQKKKKARVPNSP
APHFAMPPIHEDSLEKVFDPNVFTIGLGKKKESLAEVSPALHLLQNHDPISKLRAKRAST
EQSIVFKSLHTNSNGKSEPQTTSEASDKENRDINSGGVKRSRLENSTLFSSMLSSLPQDK
VFSPSVTSVNTMSTSFSTSQNSSVSQSSVVQPRKEGGLPCGSDKEQPHLAPHNSLKVFNF
NSSNTSRLGSSHMEKYPQKEGSKEDVNSQGNLQLPENNLSDLPKLKNSDGVEGILKSNLP
NVGSVDADFLGLFKASRYDPGHSFSGMSLSDSMTLRGSMHSKLNPRPGKVVIFSEPDVSE
ECIEVFGDIQDCSSWRLSPVIVVKVVRGCWILYEKANFEGHSLALEEGELELSSIWGTEE
MLDEEAESDKPVVIGSIRHVVQDYRISQIDLFTEPEGLGLLNSYFDDTEEMQGFPVMQKT
CSIKVHWGTWLIYEEPGFQGVPFILEPGEYPDLSFWDTEEAYIGSMRPLKMGGRKVEFPT
DPKVVIYEKPSFEGRCMELETEMSSFIMEGGETEETTGNNNLPFTSVGSMKVLRGVWVAY
EKCGFTGHQYLLEEGEYRDWNAWGGYNGELQSLRPILSDFSNAHMIMYSEKNFGSKGSSI
DVLGIVANLKETGYGVKTQSINVLSGVWVAYENPDFTGEQYVLDKGFYTSFEDWGGKNCK
ISSVQPICLDSFTGPRRRNQIHLFSEPQFQGQSQSFEETIDQIDDSFQTKSCRVLGGSWV
AYDGENFSGNQYVLEEGHYPCLSAMGCLPGATLKSLRFIDFEFSEPTIILFERENFKGKK
IELNAETVNLRSLGFNTQIRSVRVVGGIWVTYEYGNYRGRQFLLSPAEVPNWYEFSACRQ
IGSLRPFAQKRIYFRLRNKATGLFMSTNGNLEDLKLLRVQVMEDVGADDQIWIYQEGCIK
CRIAEDCCLTIVGSLVTSGSKLGLALDQNVDSQFWCMKSDGRIYSKMKPNLVLDVKGGAQ
YDQNHIILNTVSTEKLTQVWEAMVL
NT seq 6198 nt NT seq  +upstreamnt  +downstreamnt
atgccgttgtcgccaccatcgcagggcgaccccagggaggccagcccgtccaaggccccc
aagaaacaccccaccttccatatctggcgctccaagaagaagcagtctccatcgtccagc
tgtggggtgtttatccctcacccgcccggggctttcggggagaccagagctttccttgta
cccgatggaagccaaggggagccccaggagttaacactgcatggtggtgaactacagtta
tctgacacccccagtgaggtgcctggcccttcatctacggagtctgcaatgttaaaaaag
tccagagcacaaccaccagaagacaccagaaggaagccagtgttggaaaaacttggcact
ctttttacggctggaaggagaaggaacaccaggaacggattagagagtcccaccaactca
aatagcaaatcggcctctgctaaagtcccaaaaacagggagtgagaaaactaaggctcag
gacaaccaactaaaggcaaccgacgctggcgaggcgggccccaggcaggaggctgagggc
cagcccgttgagagctgtgttcaggcaaccccctgcgacgccgaacagtcaccttgctcc
agcatcaatgtaggggttgtgcagcagtgccacagcaatgattcagcccaattagaacct
ctacaggcagagggagagactttcccagatgccaccaccgctgccaaagagctgctgcat
tcctcaccagggaatcgctccaggcaggagagcgcagagacgcccgcccgcagtccgggg
gaggaagcgttgcctggcgctggcctccaaccagagacagcgagaggtgtgtcggggtcg
ccgccagaggagcacctcgtgggaggagtaggagaggcccccgacggagcccccggcgtg
ggtgccgaagcgggctctctgggggccccgggggacgcggttcctccaggtgagcctccc
gcccaggacgcagagaccagccgcacagccgggtcggtcgaccgcgcgcatcccaccaaa
gtgctaacgttggacatctacttgagcaaaactgaggtggctcaggtggacgagccggcc
tcgattgctccggggacagacgactgcgaggattcggacgacatggaaaagaggtcaagc
ggccgccggtctggtcggcggaggaagtcgcagaaatccaccgactccccgggtgcggat
gcggtggctcccgagagtgcggccaaggacgaggcggtgttcgacgacgaggtggcgcca
gacgctgcggctgagaactgcttggcggaaaggaaagtgaaatcggtacaagcggttccc
gacggaggcgcagccccggtcgcctgcccggagccaaaggccagctcctgccccagaggg
caaccccgaggggaaccggaccgcagcaagcccctgtcgcccaccaagcggaagggtcgc
agccgtgtccccgaggcggtgcccagctcgcccggcagtggctcgcgcgctcccgccaag
gagtccccacccaagagggcgcccgctgcggcggacagcggcgaggaggcgggccgcgtc
gtcccgcgcgagctcaccgtcaaaagcagctcgttgctgcccgagatcaagccagagcac
aagaggggtcctctgccccaccactttgatagccggggcgacgggggtcgcagcagggga
acaggagcgtccgacgccgacggcctgaagcccaggaaccagttcggtgtgggcaggtct
actgtgaccaccaaagtgaccctccccgccagacccaaacatgtggaactaaatctgaaa
actccgaagaatcctgacagtttgggaaatgagcacaactcatttagccagccagttcat
aaggggaacacagccaacaaaatctccttatttgaaaacaagcgggctaacagtagcccc
cgccaccccgacgtccgtaacacaaggaacaatcctccctctagtaagacatttgttggg
agggcgaagctgaacttagccaaaaaggccaaagaaatggagcaacccgaaaagaaagct
gtgtcaaccagccaccagaatggcctggtggtcaaagagccatctgcagaagggaaaggc
acagcagtccctgtccccagagaagagattcgtccagccaccagaggaggggaaggagag
tccaccaaggatcaggtcctccgccctgagcctgagcaaagtgataagctggatgtacaa
acagacactgcctatccttcccacccagggcccactgctctggttcctgtgaaggactct
gagctctcaggagagggccagccagaggctgctgacagcaaaggccccgtccttaacaac
acaagtgatgttgcacaggacatcgctgccatttgtgatgccagagaggctcccccaaag
ccacaggatgcattttctgactcacagccagcttcagcggctgagtcagctagggagtca
tctctcccgccttctgcacccatttctgtggacgctccccaagatggctgtgttcaagtt
cccatatgcagtgttccctgcactgctctagaagtgtcagaaaaccacaatgggtgtgtt
tcgccagtctctcctcacactgagaaaactcccatctccaaacctggagtgggagaagcc
agtcccccttccactccagagcacagcccagaaactatggggaaagactgtccctccaaa
gtcctcgtccaggtccggtcctttgtgcttcccgtggagaatcctcaggatgtgagctct
caggtcatctcagagagctctgaagttagagaggcacagctgccaagctgtcacagtaat
gagcctgaagtggtgtctgtcaccacttgtgttccgcagcacgaggatgcaccagacaca
tcacccaaggacatccatcacagagaaggacatgtggcacagtctcgaccacacatcaca
cagtcaggacctgagaaggctccgcccatccagagcagcagtgggatgccccagacagcg
gagttcatcctcacccactctcccagcagcagaagtcatgcagaaggcccccaaaggcca
ggtcaagatgcgaccagcccacttacccctaccaggcttttgaacatttctgctggtagt
gacaatagtgtcttggattcttcttctgatatggaaaaattcactgaaattattaaaaag
atggacagtgcagtatgtgtgccccagaaaaagaagaaggcccgggtcccaaactctcca
gcccctcacttcgctatgcctcccattcacgaggacagtttggaaaaggtgtttgatccc
aacgtgttcaccattggtttagggaagaagaaggaaagcctggcagaggtgtcaccagct
ttgcacttgttgcagaaccacgaccccatatccaaactgagagccaagcgtgcatccacc
gagcagagcatcgtcttcaagtccttgcacactaacagtaatgggaagagcgagccacag
accacttcagaagcaagtgacaaggagaacagggacatcaacagcggcggcgttaagagg
tcacggctagaaaacagcacgcttttctcaagcatgctttcttctctgccacaagacaaa
gtcttttctccctccgtgacgtcagtcaacacaatgagcacatcttttagcacttctcag
aacagctccgtatctcagtcatcagtggtacagcccaggaaggagggtggcctgccctgt
ggctcagacaaagaacagccacaccttgcaccccacaactccttaaaggtcttcaatttc
aattcatcaaatacatctcgtctgggttccagccacatggaaaagtacccacaaaaagag
ggaagcaaggaagatgtgaattctcagggcaacctacaattgccagaaaacaacctttca
gacttacccaaactgaagaacagcgatggcgtggaaggtattctgaagtcaaacctgccg
aatgttgggagcgtggacgcggacttcctgggccttttcaaagcaagccggtatgaccca
ggccattccttttctggaatgtccttatcagactctatgactcttagaggaagtatgcac
agcaaactcaacccccggcctggcaaggtagtgatattcagtgagcccgacgtctctgag
gagtgcattgaggtgtttggggacatccaggactgcagctcctggcgcctctctccagtg
atagtagtgaaagttgtccgaggatgttggattttgtatgagaaagccaattttgaaggg
cattctcttgctttagaagaaggtgaactggaactctctagtatctggggaacagaggaa
atgttggatgaagaagcagagtctgataaacctgtagtgattggttccatcagacacgtg
gttcaggattacagaattagtcagatcgacttgtttactgagcctgaagggttaggactc
ctgaactcgtactttgatgacactgaggaaatgcagggcttccctgtgatgcagaagacg
tgttccatcaaagtgcactggggcacatggctgatctatgaagagcctggattccaaggt
gtccccttcattctggagcccggagaataccctgacctatccttctgggataccgaggaa
gcgtacatcggatccatgcggcctctgaaaatgggtggccgtaaagttgaattccctaca
gatccaaaggtagttatttatgaaaagccttcctttgaaggaaggtgtatggagctagaa
acagaaatgagtagttttatcatggaaggaggtgagacagaagaaacaactggaaacaac
aacttgccctttacatccgtggggtctatgaaagtcctaagaggcgtctgggttgcttat
gagaagtgtggcttcactggccaccagtatttgctggaggagggagaatacagggactgg
aacgcctggggaggctacaatggagagctccagtctctgcggcctatattaagtgatttt
tcaaatgcgcacatgataatgtacagtgagaagaactttggctccaaaggttccagtatt
gatgtgttgggaattgttgccaatttgaaggagaccggctacggagtgaagacacagtca
atcaatgtactgagtggcgtgtgggtagcctatgaaaacccggacttcacgggggagcag
tatgtcctggataaaggcttctacaccagttttgaggattggggaggcaaaaattgtaag
atctcttccgtccaacccatatgcctggattctttcactggccccaggagacgaaatcag
attcacttgttttcagaaccacagttccaaggtcaaagtcaaagttttgaagaaacaata
gatcagattgacgactcctttcagaccaagtcttgcagagttttgggaggcagctgggtt
gcttatgatggagaaaatttctctggcaatcagtatgtactggaagaaggccactatcct
tgtctctcggcaatgggatgcctgcctggagcaaccctgaagtctcttcgctttatagat
tttgaattttccgaaccaacaattattcttttcgaaagagaaaacttcaaaggaaaaaag
atagaactgaacgcagaaacagtcaatctccgatccttggggttcaacactcagatccgc
tctgtgcgggtcgttggtggcatatgggttacctatgaatatggcaattacagaggccgg
cagttcctgctgtctcctgcagaagtaccaaactggtatgagttcagtgcctgtcgccaa
ataggctccctccggccctttgctcagaaacgaatttacttcagacttcgaaacaaagca
acaggactatttatgtcaaccaacgggaacttggaagacctgaagcttctccgagtccag
gtcatggaagatgttggtgctgatgatcagatctggatctatcaagaagggtgcatcaaa
tgcaggatagcagaagactgctgcctgacgatcgtgggcagcctcgtcacgtctggctcc
aaactaggactggccctcgatcaaaatgtcgacagtcagttctggtgcatgaagtccgac
ggcaggatctacagcaagatgaaaccaaatttagtgttggatgtgaaagggggtgcgcag
tatgatcaaaatcacatcatcctcaacacagtgagcacagagaagttaacacaagtgtgg
gaagccatggtcctgtga

DBGET integrated database retrieval system