KEGG   Mus musculus (mouse): 11636
Entry
11636             CDS       T01002                                 

Symbol
Ak1, Ak-1, B430205N08Rik
Name
(RefSeq) adenylate kinase 1
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00230  Purine metabolism
mmu00730  Thiamine metabolism
mmu01100  Metabolic pathways
mmu01240  Biosynthesis of cofactors
Module
mmu_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    11636 (Ak1)
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    11636 (Ak1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    11636 (Ak1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     11636 (Ak1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   11636 (Ak1)
SSDB
Motif
Pfam: ADK AAA_17 AAA_33 AAA_18 Thymidylate_kin Cytidylate_kin Zeta_toxin dNK CPT AAA_19 AAA_22 NTPase_1
Other DBs
NCBI-GeneID: 11636
NCBI-ProteinID: NP_001185719
MGI: 87977
Ensembl: ENSMUSG00000026817
Vega: OTTMUSG00000011984
UniProt: Q9R0Y5
Position
2:32511770..32525070
AA seq 194 aa
MEEKLKKAKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRAEVSSGSERGKKLSAI
MEKGELVPLDTVLDMLRDAMLAKVDSSNGFLIDGYPREVKQGEEFEQKIGQPTLLLYVDA
GAETMTQRLLKRGETSGRVDDNEETIKKRLETYYNATEPVISFYDKRGIVRKVNAEGTVD
TVFSEVCTYLDSLK
NT seq 585 nt   +upstreamnt  +downstreamnt
atggaagagaagctgaagaaggccaagatcatctttgtggtgggcggacctggctcagga
aagggcacccagtgcgagaagattgtacagaaatatggctacacccacctgtctactggg
gacctgcttcgggcagaagtcagctctggatcggagaggggcaagaagctgtcggctatc
atggagaagggagagctagtgccactggacacggtgctggacatgctccgagatgctatg
ttagccaaagtggattcttccaatggcttcctgatcgacggctacccgagggaggtgaaa
cagggagaagaatttgaacagaagattggacagcccacactgctgctgtatgtggacgca
ggcgccgagaccatgacccaacgactcctgaagcgaggggagaccagtggccgcgtggat
gacaacgaggagaccatcaagaagcggctggagacttattacaatgccacagaacctgtc
atctccttctatgacaagcgtggcattgtgcgcaaggtcaatgccgaaggcacggtggac
actgtcttctctgaggtctgcacctatcttgactccctgaagtaa

DBGET integrated database retrieval system