KEGG   Mus musculus (mouse): 11637Help
Entry
11637             CDS       T01002                                 

Gene name
Ak2, Ak-2, D4Ertd220e
Definition
(RefSeq) adenylate kinase 2
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00230  Purine metabolism
mmu00730  Thiamine metabolism
mmu01100  Metabolic pathways
Module
mmu_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    11637 (Ak2)
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    11637 (Ak2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    11637 (Ak2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     11637 (Ak2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   11637 (Ak2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADK AAA_17 ADK_lid AAA_33 Cytidylate_kin AAA_18 AAA_28 Aminotran_3
Motif
Other DBs
NCBI-GeneID: 11637
NCBI-ProteinID: NP_001029138
MGI: 87978
Ensembl: ENSMUSG00000028792
Vega: OTTMUSG00000009623
UniProt: Q9WTP6
Position
4 D2.2; 4 62.62 cM
AA seq 239 aa AA seqDB search
MAPNVLASEPEIPKGIRAVLLGPPGAGKGTQAPKLAENFCVCHLATGDMLRAMVASGSEL
GKKLKATMDAGKLVSDEMVVELIEKNLETPSCKNGFLLDGFPRTVRQAEMLDDLMEKRKE
KLDSVIEFSIQDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNE
KALKTRLEAYHTQTTPLVEYYRKRGIHCAIDASQTPDIVFASILAAFSKATCKDLVMFI
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggctcccaacgtgttggcttccgaaccggagattccgaagggcatccgggccgtgttg
ctggggccgcccggggctggcaaggggacgcaggcacccaaactggctgaaaacttttgt
gtctgtcatttggccaccggggacatgctgagagccatggtagcttctggctcagagcta
ggaaaaaagctgaaggcgacaatggatgcagggaaactggtgagtgacgaaatggttgtg
gagctaattgagaagaatttggagactccttcgtgcaaaaatggctttcttctagatggc
ttccctcggactgtgaggcaggctgaaatgcttgatgacctcatggagaagaggaaagag
aagctcgattcagtcattgagttcagcatccaagactcgctgctgatccggaggatcact
gggaggctgattcaccccaagagtggccggtcctaccatgaggaattcaaccctccaaag
gagcccatgaaagatgatatcactggggagcccctgatccgcaggtcagatgacaacgag
aaagccttgaagacccgcctggaggcctaccacactcagaccactccgctcgtggagtac
tacaggaaacgcggcattcactgcgccatcgatgcgtcccagacccctgacatcgtgttt
gcgagcatcctggcagccttctccaaagccacatgtaaagacctggtcatgtttatctaa

DBGET integrated database retrieval system