KEGG   Mus musculus (mouse): 11640
Entry
11640             CDS       T01002                                 

Gene name
Akap1, AKAP121, AKAP84, Akap, C76494, C81186, DAKAP1, S-AKAP84
Definition
(RefSeq) A kinase (PRKA) anchor protein 1
  KO
K16518  A-kinase anchor protein 1, mitochondrial
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    11640 (Akap1)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     11640 (Akap1)
SSDB
Motif
Pfam: TUDOR KH_1 RII_binding_1 Agenet KH_4
Other DBs
NCBI-GeneID: 11640
NCBI-ProteinID: NP_001036006
MGI: 104729
Ensembl: ENSMUSG00000018428
Vega: OTTMUSG00000001272
UniProt: O08715 Q9CTT7
Position
11; 11 C
AA seq 857 aa
MAIQLRSLFPLALPGMLALLGWWWFFSRKKDRLSSSDKQVETLKVGPAIKDRRLSEEACP
GVLSVAPTVTQPPGREEQRCVDKPSTEPLALPRTRQVRRRSESSGNLPSVADTRSQPGPC
RDEIAKVELSLMGDKAKSIPLGCPLLPKDASFPYEAVERCKQESALGKTPGRGWPSPYAA
SGEKARETGGTEGTGDAVLGENVSEEGLLSQECVSEVEKSEFPILAPGGGEGEEVSHGPP
QVAELLKKEEYIVGKLPSSFVEPVHSEPVKDEDALEPQVKGSSNTSDRDLAGELDKDETV
PENDQIKQAAFQLISQVILEATEEFRATTVGKTVAQVHPTSATQPKGKEESCVPASQETS
LGQDTSDPASTRTGATASPSAEALPPKTYVSCLSSPLSGPTKDQKPKNSAHHISLAPCPP
PVTPQRQSLEGASNPRGDDNFVACMANNSQSVLSVSSLGQCSDPVSTSGLEDSCTETISS
SGDKAMTPPLPVSTQPFSNGVLKEELSDLGTEDGWTMDTEADHSGGSDGNSMDSVDSCCG
LTKPDSPQSVQAGSNPKKVDLIIWEIEVPKHLVGRLIGKQGRYVSFLKQTSGAKIYISTL
PYTQNIQICHIEGSQHHVDKALNLIGKKFKELNLTNIYAPPLPSLALPSLPMTSWLMLPD
GITVEVIVVNQVNAGHLFVQQHTHPTFHALRSLDQQMYLCYSQPGIPTLPTPVEITVICA
APGADGAWWRAQVVASYEETNEVEIRYVDYGGYKRVKVDVLRQIRSDFVTLPFQGAEVLL
DSVVPLSDDDHFSPEADAAMSEMTGNTALLAQVTSYSATGLPLIQLWSVVGDEVVLINRS
LVERGLAQWVDSYYASL
NT seq 2574 nt   +upstreamnt  +downstreamnt
atggcaatccagttgcgttcgctcttccccttggcgttgcccggaatgctggccctcctt
ggctggtggtggtttttctctcgtaaaaaagatcggctcagcagcagtgataagcaggtg
gagacactgaaggttggccctgccatcaaggaccgacggctcagtgaagaggcctgtcct
ggagtcctgtctgtggcccccactgtcacacagcctcctggaagggaagagcagcgctgt
gtggacaagccttctacagagcccctggccttgccgaggactcgccaggttcgacgaaga
tcagagtcctcaggcaacctccccagcgttgcagacacgaggtcgcagccaggaccgtgc
agagatgagatcgccaaagtggaactctccctgatgggggacaaagccaaatctattcct
cttggatgtccgcttctcccaaaggatgcgtccttcccctatgaagcagtggaaaggtgt
aagcaggagtccgcactgggcaagactcctggaagaggctggccaagcccgtatgcggcc
tctggagagaaagcgagagagacaggtgggacagaggggactggagatgctgtgttgggg
gaaaatgtatctgaggaaggcctattgtcccaggagtgtgtctcagaagtggagaagagt
gagtttccaatcctggcccccgggggaggtgagggagaagaggtgagccatggcccccca
caggtagctgaacttttaaagaaggaagaatatattgttgggaagttgccgagtagcttt
gtggagccagttcactcagagccggttaaggacgaggatgcgttggaaccccaggtcaaa
ggtagcagcaatacttcggatagagacctggctggagagctggacaaagacgagaccgtg
cctgaaaatgaccagattaagcaggctgccttccagctcatctcccaggtgatcttggaa
gcaactgaagagtttcgggccaccacagtgggcaagactgtggcacaagtgcacccaacc
tcggccactcagcctaaggggaaggaggagagctgtgttccagccagccaggaaactagc
ttgggacaagacacctcagatcctgcttccaccagaacaggtgccactgccagcccttca
gcagaagctctgccaccaaagacctatgtaagctgtctcagcagccctctgtcaggcccc
accaaggaccagaagccaaagaactctgcacatcacatctccctggctccctgcccaccg
ccagtcaccccccagaggcagtctctggagggggcaagtaacccgagaggtgatgacaac
tttgtcgcctgtatggccaacaacagccagagtgtcctttcagttagctccttggggcag
tgctcagatcctgtcagtacttcggggcttgaagactcttgcacagagaccatctcaagc
tccggagacaaagctatgaccccaccactgccagtcagtactcagcccttcagcaacggg
gtgctgaaggaggagctgtcagacttagggaccgaggatggatggaccatggatacagaa
gcagatcactcaggaggttctgacgggaacagtatggattcagtggatagctgttgcggg
cttaccaagcccgatagcccccagagtgtccaggcaggctccaaccctaagaaggttgac
cttatcatctgggagatcgaggtgccaaagcacttagttggtcgactgattggcaagcag
ggacggtacgtgagttttctgaagcagacatctggtgccaagatctacatctccaccctg
ccttacacacagaacatccagatctgccacatagaaggctctcagcaccatgtagacaaa
gctctgaacttgattgggaagaagtttaaggaactgaacctcaccaatatctatgcgcca
ccactgccttcgctggcactgccttccttgccgatgacgtcttggctcatgctgcctgat
ggtatcactgtggaagtcatcgtggtcaaccaggtcaatgctgggcacctatttgtccag
cagcacacacaccccaccttccatgcactgcgcagtctggaccagcagatgtacctctgt
tactctcagcctggaatccccaccttgcccaccccagtggaaatcacggttatctgcgct
gcccctggtgcggacggggcctggtggcgagcccaagtagtggcttcctatgaggagacc
aatgaggtggagattcgctacgtggactatggtggatataagagagtgaaagtcgacgtg
ctccggcaaattaggtctgactttgtgaccctgccattccaaggagcagaagtccttctg
gacagtgtggttcctctgtcagatgatgatcatttttcaccggaggcagacgcagccatg
agtgagatgacaggcaatacagcactgttggcccaggtgacaagctacagtgcgactggc
cttcctctgattcagctatggagtgtggttggagatgaagtggtgttgataaaccggtcg
ctggtggagcgaggccttgcacagtgggtagacagctactatgccagcctctga

DBGET integrated database retrieval system