KEGG   Mus musculus (mouse): 11642Help
Entry
11642             CDS       T01002                                 

Gene name
Akap3, Prka3
Definition
(RefSeq) A kinase (PRKA) anchor protein 3
  KO
K16520  A-kinase anchor protein 3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    11642 (Akap3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AKAP_110 RII_binding_1 PARG_cat
Motif
Other DBs
NCBI-GeneID: 11642
NCBI-ProteinID: NP_033780
MGI: 1341149
Ensembl: ENSMUSG00000030344
Vega: OTTMUSG00000056337
UniProt: O88987
Position
6; 6 F3
AA seq 864 aa AA seqDB search
MADRVDWLQSQSGVCKVGVYSPGDNQHQDWKMDTSTDPVRVLSWLRKDLEKSTAGFQDSR
FKPGESSFVEEVAYPVDQRKGFCVDYYNTTNKGSPGRLHFEMSHKENPSQGLISHVGNGG
SIDEVSFYANRLTNLVIAMARKEINEKIHGAENKCVHQSLYMGDEPTPHKSLSTVASELV
NETVTACSKNISSDKAPGSGDRASGSSQAPGLRYTSTLKIKESTKEGKCPDDKPGTKKSF
FYKEVFESRNAGDAKEGGRSLPGDQKLFRTSPDNRPDDFSNSISQGIMTYANSVVSDMMV
SIMKTLKIQVKDTTIATILLKKVLMKHAKEVVSDLIDSFMKNLHGVTGSLMTDTDFVSAV
KRSFFSHGSQKATDIMDAMLGKLYNVMFAKKFPENIRRARDKSESYSLISTKSRAGDPKL
SNLNFAMKSESKLKENLFSTCKLEKEKTCAETLGEHIIKEGLHMWHKSQQKSPGLERAAK
LGNAPQEVSFECPDPCEANPPHQPQPPENFANFMCDSDSWAKDLIVSALLLIQYHLAQGG
KMDAQSFLEAAASTNFPTNKPPPPSPVVQDECKLKSPPHKICDQEQTEKKDLMSVIFNFI
RNLLSETIFKSSRNCESNVHEQNTQEEEIHPCERPKTPCERPITPPAPKFCEDEEATGGA
LSGLTKMVANQLDNCMNGQMVEHLMDSVMKLCLIIAKSCDSPLSELGEEKCGDASRPNSA
FPDNLYECLPVKGTGTAEALLQNAYLTIHNELRGLSGQPPEGCEIPKVIVSNHNLADTVQ
NKQLQAVLQWVAASELNVPILYFAGDDEGIQEKLLQLSATAVEKGRSVGEVLQSVLRYEK
ERQLDEAVGNVTRLQLLDWLMANL
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
atggcggatagggttgactggttacaaagtcaaagtggcgtttgcaaagttggtgtctat
tcacctggagacaaccaacaccaagactggaaaatggacacatcaacagatcctgtccga
gtgctcagctggctccgcaaagacctggagaaaagtacagcgggcttccaggactcgagg
ttcaagcctggagagtcatcgtttgtggaggaagtggcttacccagtggaccaacgaaaa
ggtttctgtgttgattattacaataccaccaacaagggcagtccaggaagattgcatttt
gagatgtctcacaaggagaacccttcccagggcctcatttcccatgttggtaatgggggt
tccatagacgaagtttccttctatgccaaccgcctcacaaacctagtgatcgccatggcc
cgaaaggagatcaatgagaagatccacggcgctgaaaacaaatgtgtccatcagtcattg
tatatgggggatgagcccacaccccacaaaagcttgagtacagtggcctctgagctcgtg
aacgagacagtcaccgcatgttccaagaacatttccagtgacaaagctcccggctctgga
gacagggcctcggggtcgtcacaggcccctggtctaagatacacgagcactctgaagatc
aaggagagtacaaaggaaggcaagtgtccagacgacaagcccggcactaagaagtctttc
ttctataaggaagtgtttgagtcccggaatgcaggagatgccaaggagggcgggaggtcc
ttaccaggagatcaaaaactgttcaggaccagccccgacaacaggcctgatgacttttca
aactctatcagtcaagggatcatgacctacgccaacagcgtggtgtctgacatgatggtc
tccatcatgaagacgctgaagatccaggtgaaggacacaaccatcgccacgattctgctg
aagaaggtgctgatgaagcacgcaaaggaggttgtctccgacctcatcgactccttcatg
aagaacctccacggcgtcacgggaagcctcatgactgacacagactttgtctcggccgtg
aaacgaagttttttttctcatggaagccaaaaggccacagatatcatggatgccatgctg
ggcaagctatacaatgtgatgtttgccaagaaattccctgagaacatccggagagccagg
gacaagtcggagagttactcccttatctccacgaaatcacgggctggtgacccaaagctc
tcaaatttgaactttgcgatgaagtcagaatcaaagctgaaagaaaatttgttttctaca
tgcaaactagagaaagagaagacgtgtgccgaaactctgggtgagcatattattaaggag
ggactgcacatgtggcacaagagtcagcaaaaatctcctggcttggagcgtgccgcaaaa
ctgggtaacgctccacaggaggtctcctttgagtgcccagatccttgtgaggcaaaccct
cctcaccaacctcagccaccagagaattttgcaaattttatgtgtgactcagactcctgg
gccaaggacctgattgtatccgccctgcttctgattcagtatcacctggcacagggagga
aagatggatgctcagagcttcctggaagctgctgccagcaccaattttcccaccaacaag
ccacctcctccttctcctgtagttcaggatgagtgcaaacttaagtctcctccccacaag
atatgtgaccaagaacaaacagaaaagaaagatctgatgagtgtcatcttcaattttatc
cggaacttactcagcgagaccatattcaagagtagccgtaactgtgaatccaatgtgcat
gagcagaacactcaggaagaagagatacacccgtgtgaaaggcctaagactccatgtgaa
aggcctattaccccgcctgccccgaaattctgtgaggatgaggaggccactggtggtgcc
ttatctgggctaaccaagatggttgccaaccagctagacaactgtatgaatgggcagatg
gtggagcacctgatggactcggtgatgaagttatgcctcattattgccaagtcctgtgac
tctcccctgtcggagctgggagaggaaaagtgtggggatgccagccggccaaattctgcc
ttcccagataacttatatgagtgcctaccagtcaagggcacagggacagctgaagccctc
ctgcagaacgcctacctcaccatccataatgaactgagaggtttgtcaggacagcccccc
gagggctgtgaaatccccaaggtgatcgtcagcaaccacaatctggctgacaccgttcag
aacaagcaactgcaagctgtccttcagtgggtggctgcctcagagctcaatgtccctatt
ttgtactttgctggtgacgatgaaggaatccaggagaagctgcttcagctctcagccact
gccgtggagaaaggccgcagcgtcggggaggttctgcagtcggtgctgaggtacgagaag
gagcgacagctggatgaagcagtgggaaatgtcacgcggctgcagctgctggactggctg
atggcaaacctgtga

DBGET integrated database retrieval system