KEGG   Mus musculus (mouse): 11655
Entry
11655             CDS       T01002                                 

Gene name
Alas1, A, ALAS, ALAS-N, Al, Alas-1, Alas-h
Definition
(RefSeq) aminolevulinic acid synthase 1
  KO
K00643  5-aminolevulinate synthase [EC:2.3.1.37]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00260  Glycine, serine and threonine metabolism
mmu00860  Porphyrin and chlorophyll metabolism
mmu01100  Metabolic pathways
mmu01240  Biosynthesis of cofactors
Module
mmu_M00868  Heme biosynthesis, animals and fungi, glycine => heme
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    11655 (Alas1)
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    11655 (Alas1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mmu01007]
    11655 (Alas1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.37  5-aminolevulinate synthase
     11655 (Alas1)
Amino acid related enzymes [BR:mmu01007]
 Aminotransferase (transaminase)
  Class II
   11655 (Alas1)
SSDB
Motif
Pfam: Aminotran_1_2 Preseq_ALAS Cys_Met_Meta_PP Aminotran_5 Beta_elim_lyase
Other DBs
NCBI-GeneID: 11655
NCBI-ProteinID: NP_001278764
MGI: 87989
Ensembl: ENSMUSG00000032786
Vega: OTTMUSG00000033383
UniProt: Q8VC19 Q3V0B2
Position
9; 9 F1
AA seq 642 aa
METVVRRCPFLSRVPQAFLQKAGKSLLFYAQNCPKMMEVGAKPAPRTLSTSAVHCQQVKE
TPPANEKEKTAKAAVQQAPDESQMAQTPDGTQLPSGHPSPATSQGSGSKCPFLAAQLSQT
GSSVFRKASLELQEDVQEMHAVRKEAAQSPVPPSLVNVKTDGEDPSRLLKNFQDIMRKQR
PERVSHLLQDNLPKSVSTFQYDHFFEKKIDEKKNDHTYRVFKTVNRRAQIFPMADDYTDS
LITKKQVSVWCSNDYLGMSRHPRVCGAVMETVKQHGAGAGGTRNISGTSKFHVELEQALA
DLHGKDAALLFSSCFVANDSTLFTLAKMMPGCEIYSDSGNHASMIQGIRNSRVPKYIFRH
NDVNHLRELLQRSDPSVPKIVAFETVHSMDGAVCPLEELCDVAHEFGAITFVDEVHAVGL
YGARGGGIGDRDGVMPKMDIISGTLGKAFGCVGGYIASTSLLIDTVRSYAAGFIFTTSLP
PMLLAGALESVRILKSSEGRALRRQHQRNVKLLRQMLMDAGLPVIHCPSHIIPVRVADAA
KNTEICDELMTRHNIYVQAINYPTVPRGEELLRIAPTPHHTPQMMNFFVEKLLVTWKRVG
LELKPHSSAECNFCRRPLHFEVMSEREKAYFSGMSKMVSAQA
NT seq 1929 nt   +upstreamnt  +downstreamnt
atggagactgtcgttcgccgatgcccattcttatcccgagtccctcaggcctttctgcag
aaggcaggaaagtctctgttgttctatgctcaaaactgccccaagatgatggaagttggg
gccaagccagctcctcgaaccctgtccacatcagctgtccactgccagcaggtcaaagaa
acccctccagccaatgagaaagagaaaactgccaaggccgcagtccagcaggctcctgac
gagtcccagatggcacagactccagacggcacacagcttccgtctggacacccgtcccct
gctacaagccagggctctgggagcaagtgccctttcctggcagcacagctgagccagaca
ggcagcagcgtcttccgcaaggccagtctggagctccaggaggacgtgcaggaaatgcat
gctgtgaggaaagaggctgctcaaagcccagtgcctcccagcctggttaatgtgaaaacc
gatggagaggatccaagccgactgctgaagaacttccaggacatcatgcgaaagcagagg
ccagaaagagtgtctcatcttcttcaggataacttgccaaagtctgtttccacttttcaa
tatgatcatttctttgagaagaaaattgatgagaaaaaaaatgatcatacctaccgagtt
tttaaaacggtgaaccggagagcacaaatcttcccgatggcggatgactacacggattcc
ctcataaccaaaaagcaggtgtcggtctggtgcagtaatgactacctaggcatgagtcga
cacccacgggtgtgtggggctgtcatggagactgtgaaacagcatggtgctggagctggg
ggaactaggaatatttctggaacgagcaagttccacgtagaactggagcaggcactggcc
gacctccacggcaaagatgcggcgctcttgttctcttcctgttttgtggccaacgactcc
accctcttcaccctggctaagatgatgccaggctgtgaaatttactctgattccgggaac
catgcctccatgatccaagggattcgcaacagtcgagtgccaaaatatatcttccgccac
aatgacgttaaccatctcagagaactgctgcagagatctgacccctcagtccccaagata
gtagcatttgaaactgtccattcaatggatggagcagtgtgcccactggaagagctgtgt
gacgtggcccatgagtttggggcaatcacgtttgtggatgaggtccatgcagtggggctc
tatggagctcgaggtggagggatcggtgatcgggatggcgtcatgccaaaaatggacatc
atctctgggacgcttggtaaagcgttcggctgtgttggaggatacattgccagcacgagt
ttgctgatcgacaccgtccgctcctacgctgcgggcttcatcttcaccacctccttgcca
ccaatgctgctggctggagccctggagtctgtgcggatcctgaagagcagcgaggggcgc
gcccttcgccgccagcaccagcgaaatgtcaagcttctgaggcagatgctaatggacgct
ggcctcccggtcatccactgtccgagtcacatcatccctgtgcgggttgccgatgctgct
aagaacacagagatctgtgatgagttgatgaccaggcataatatctacgtccaggccatc
aattacccaacagtgcctcgcggggaggagctcctgcggatcgcccccaccccgcatcac
accccgcagatgatgaacttcttcgtggagaagctgctggtcacgtggaagcgagttggg
ctggaacttaagccacattcgtcagctgaatgcaacttctgcaggaggcccctgcacttt
gaagtgatgagcgaaagagagaaagcctatttctcaggcatgagcaagatggtgtctgcc
caggcctga

DBGET integrated database retrieval system