KEGG   Mus musculus (mouse): 11656Help
Entry
11656             CDS       T01002                                 

Gene name
Alas2, ALAS, ALAS-E, ALASE, Alas-2
Definition
(RefSeq) aminolevulinic acid synthase 2, erythroid
  KO
K00643  5-aminolevulinate synthase [EC:2.3.1.37]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00260  Glycine, serine and threonine metabolism
mmu00860  Porphyrin and chlorophyll metabolism
mmu01100  Metabolic pathways
Module
mmu_M00868  Heme biosynthesis, animals and fungi, glycine => heme
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    11656 (Alas2)
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    11656 (Alas2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mmu01007]
    11656 (Alas2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.37  5-aminolevulinate synthase
     11656 (Alas2)
Amino acid related enzymes [BR:mmu01007]
 Aminotransferase (transaminase)
  Class II
   11656 (Alas2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Preseq_ALAS Aminotran_5 Cys_Met_Meta_PP DegT_DnrJ_EryC1 Mustang
Motif
Other DBs
NCBI-GeneID: 11656
NCBI-ProteinID: NP_033783
MGI: 87990
Ensembl: ENSMUSG00000025270
Vega: OTTMUSG00000019150
UniProt: P08680 A2AFM0
Structure
PDB: 

Position
X F3; X 68.46 cM
AA seq 587 aa AA seqDB search
MVAAAMLLRSCPVLSQGPTGLLGKVAKTYQFLFSIGRCPILATQGPTCSQIHLKATKAGG
DSPSWAKSHCPFMLSELQDRKSKIVQRAAPEVQEDVKTFKTDLLSTMDSTTRSHSFPSFQ
EPEQTEGAVPHLIQNNMTGSQAFGYDQFFRDKIMEKKQDHTYRVFKTVNRWANAYPFAQH
FSEASMASKDVSVWCSNDYLGISRHPRVLQAIEETLKNHGAGAGGTRNISGTSKFHVELE
QELAELHQKDSALLFSSCFVANDSTLFTLAKLLPGCEIYSDAGNHASMIQGIRNSGAAKF
VFRHNDPGHLKKLLEKSDPKTPKIVAFETVHSMDGAICPLEELCDVAHQYGALTFVDEVH
AVGLYGARGAGIGERDGIMHKLDIISGTLGKAFGCVGGYIASTRDLVDMVRSYAAGFIFT
TSLPPMVLSGALESVRLLKGEEGQALRRAHQRNVKHMRQLLMDRGFPVIPCPSHIIPIRV
GNAALNSKICDLLLSKHSIYVQAINYPTVPRGEELLRLAPSPHHSPQMMENFVEKLLLAW
TEVGLPLQDVSVAACNFCHRPVHFELMSEWERSYFGNMGPQYVTTYA
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atggtggcagcagctatgttgctacggtcctgtccagtgctctctcagggccccacaggc
ctcctgggcaaagtggctaaaacctaccagttcctatttagtattggacgctgccccatc
ctggccactcaaggaccaacctgttctcaaatccatcttaaggcaaccaaggctggagga
gactctccatcttgggctaagagccattgtcctttcatgctgtcagaactccaagacagg
aagagcaagattgtgcagagggcagctccagaagttcaagaggatgtcaagactttcaag
acagacctgctgagcaccatggattcaaccacccgaagccattcatttcctagtttccag
gagccagagcagactgaaggggcagttccccacctgattcagaacaatatgactggaagc
caggctttcggttatgaccaatttttcagagacaagatcatggagaagaaacaggaccac
acctaccgtgtgttcaagactgtgaatcgttgggctaatgcctacccctttgcccaacac
ttctccgaggcatctatggcatcaaaggatgtttctgtttggtgtagtaatgactatttg
ggcataagcagacaccctcgtgtcttgcaggccatagaggagaccctgaagaatcatgga
gctggagctgggggcactcgcaatatctcaggtaccagcaagtttcatgtggagcttgaa
caggagctggctgaactacaccagaaagactcagctctgctcttctcctcctgttttgtg
gccaatgattctactctctttacactggccaagcttctgccagggtgtgagatctactca
gatgcaggcaatcatgcctccatgatccaaggcattcgcaacagtggtgcagccaagttt
gtcttcagacacaatgacccaggccacctgaagaaacttctcgagaagtctgatcccaag
acaccaaaaattgtggcttttgagactgttcattccatggatggtgccatctgtcctctg
gaggaattgtgtgatgtggcccaccagtatggagccctgaccttcgtagatgaagtccat
gctgtaggactgtatggagcccggggtgcaggtatcggggagcgtgatggaattatgcac
aagcttgacatcatctctggaactcttggcaaggcctttggttgcgtcggtggctatata
gccagcactcgggacttggtggacatggtgcgctcctacgctgcaggcttcatctttacc
acttcactgcctcccatggtgctctctggggctctagaatctgtgcgcctactcaaggga
gaggagggtcaagccctgaggcgggcacaccagcgcaatgtcaaacacatgcgccagctg
ctaatggacaggggctttcctgttatcccctgtcccagccacatcatccccatcagggtg
ggtaatgcagcactcaacagcaagatctgtgatcttctgctctccaagcacagcatctat
gtgcaggccatcaactacccaactgtgcctcgtggtgaggagctactgcgcttggccccc
tccccccaccacagccctcagatgatggaaaactttgtggagaagctgctgctggcctgg
actgaggtggggctgcccctccaagatgtgtctgtggctgcatgcaacttctgtcatcgt
cctgtgcactttgaacttatgagcgagtgggagcgatcctactttgggaacatgggaccc
caatatgttaccacctatgcttaa

DBGET integrated database retrieval system