KEGG   Mus musculus (mouse): 11657Help
Entry
11657             CDS       T01002                                 

Gene name
Alb, Alb-1, Alb1, BCL002
Definition
(RefSeq) albumin
  KO
K16141  serum albumin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    11657 (Alb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    11657 (Alb)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   11657 (Alb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Serum_albumin VitD-bind_III
Motif
Other DBs
NCBI-GeneID: 11657
NCBI-ProteinID: NP_033784
MGI: 87991
Ensembl: ENSMUSG00000029368
Vega: OTTMUSG00000055485
UniProt: P07724 Q546G4
Position
5 E1; 5 44.7 cM
AA seq 608 aa AA seqDB search
MKWVTFLLLLFVSGSAFSRGVFRREAHKSEIAHRYNDLGEQHFKGLVLIAFSQYLQKCSY
DEHAKLVQEVTDFAKTCVADESAANCDKSLHTLFGDKLCAIPNLRENYGELADCCTKQEP
ERNECFLQHKDDNPSLPPFERPEAEAMCTSFKENPTTFMGHYLHEVARRHPYFYAPELLY
YAEQYNEILTQCCAEADKESCLTPKLDGVKEKALVSSVRQRMKCSSMQKFGERAFKAWAV
ARLSQTFPNADFAEITKLATDLTKVNKECCHGDLLECADDRAELAKYMCENQATISSKLQ
TCCDKPLLKKAHCLSEVEHDTMPADLPAIAADFVEDQEVCKNYAEAKDVFLGTFLYEYSR
RHPDYSVSLLLRLAKKYEATLEKCCAEANPPACYGTVLAEFQPLVEEPKNLVKTNCDLYE
KLGEYGFQNAILVRYTQKAPQVSTPTLVEAARNLGRVGTKCCTLPEDQRLPCVEDYLSAI
LNRVCLLHEKTPVSEHVTKCCSGSLVERRPCFSALTVDETYVPKEFKAETFTFHSDICTL
PEKEKQIKKQTALAELVKHKPKATAEQLKTVMDDFAQFLDTCCKAADKDTCFSTEGPNLV
TRCKDALA
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgggtaacctttctcctcctcctcttcgtctccggctctgctttttccaggggt
gtgtttcgccgagaagcacacaagagtgagatcgcccatcggtataatgatttgggagaa
caacatttcaaaggcctagtcctgattgccttttcccagtatctccagaaatgctcatac
gatgagcatgccaaattagtgcaggaagtaacagactttgcaaagacgtgtgttgccgat
gagtctgccgccaactgtgacaaatcccttcacactctttttggagataagttgtgtgcc
attccaaacctccgtgaaaactatggtgaactggctgactgctgtacaaaacaagagccc
gaaagaaacgaatgtttcctgcaacacaaagatgacaaccccagcctgccaccatttgaa
aggccagaggctgaggccatgtgcacctcctttaaggaaaacccaaccacctttatggga
cactatttgcatgaagttgccagaagacatccttatttctatgccccagaacttctttac
tatgctgagcagtacaatgagattctgacccagtgttgtgcagaggctgacaaggaaagc
tgcctgaccccgaagcttgatggtgtgaaggagaaagcattggtctcatctgtccgtcag
agaatgaagtgctccagtatgcagaagtttggagagagagcttttaaagcatgggcagta
gctcgtctgagccagacattccccaatgctgactttgcagaaatcaccaaattggcaaca
gacctgaccaaagtcaacaaggagtgctgccatggtgacctgctggaatgcgcagatgac
agggcggaacttgccaagtacatgtgtgaaaaccaggcgactatctccagcaaactgcag
acttgctgcgataaaccactgttgaagaaagcccactgtcttagtgaggtggagcatgac
accatgcctgctgatctgcctgccattgctgctgattttgttgaggaccaggaagtgtgc
aagaactatgctgaggccaaggatgtcttcctgggcacgttcttgtatgaatattcaaga
agacaccctgattactctgtatccctgttgctgagacttgctaagaaatatgaagccact
ctggaaaagtgctgcgctgaagccaatcctcccgcatgctacggcacagtgcttgctgaa
tttcagcctcttgtagaagagcctaagaacttggtcaaaaccaactgtgatctttacgag
aagcttggagaatatggattccaaaatgccattctagttcgctacacccagaaagcacct
caggtgtcaaccccaactctcgtggaggctgcaagaaacctaggaagagtgggcaccaag
tgttgtacacttcctgaagatcagagactgccttgtgtggaagactatctgtctgcaatc
ctgaaccgtgtgtgtctgctgcatgagaagaccccagtgagtgagcatgttaccaagtgc
tgtagtggatccctggtggaaaggcggccatgcttctctgctctgacagttgatgaaaca
tatgtccccaaagagtttaaagctgagaccttcaccttccactctgatatctgcacactt
ccagagaaggagaagcagattaagaaacaaacggctcttgctgagctggtgaagcacaag
cccaaggctacagcggagcaactgaagactgtcatggatgactttgcacagttcctggat
acatgttgcaaggctgctgacaaggacacctgcttctcgactgagggtccaaaccttgtc
actagatgcaaagacgccttagcctaa

DBGET integrated database retrieval system