KEGG   Mus musculus (mouse): 11658
Entry
11658             CDS       T01002                                 

Gene name
Alcam, AI853494, BEN, CD166, DM-GRASP, MuSC, SC1
Definition
(RefSeq) activated leukocyte cell adhesion molecule
  KO
K06547  activated leukocyte cell adhesion molecule
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    11658 (Alcam)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    11658 (Alcam)
   04090 CD molecules [BR:mmu04090]
    11658 (Alcam)
Cell adhesion molecules [BR:mmu04515]
 Immunoglobulin superfamily
  ALCAM
   11658 (Alcam)
CD molecules [BR:mmu04090]
 Proteins
  11658 (Alcam)
SSDB
Motif
Pfam: Ig_3 C2-set_2 Ig_2 I-set ig C1-set V-set CD34_antigen Amnionless Podoplanin FixQ PepSY_TM
Other DBs
NCBI-GeneID: 11658
NCBI-ProteinID: NP_033785
MGI: 1313266
Ensembl: ENSMUSG00000022636
Vega: OTTMUSG00000036124
UniProt: Q61490 Q54AJ5 Q3TTY3
Position
16; 16 B5
AA seq 583 aa
MASKVSPSCRLVFCLLISAAVLRPGLGWYTVNSAYGDTIVMPCRLDVPQNLMFGKWKYEK
PDGSPVFIAFRSSTKKSVQYDDVPEYKDRLSLSENYTLSIANAKISDEKRFVCMLVTEDN
VFEAPTLVKVFKQPSKPEIVNKAPFLETDQLKKLGDCISRDSYPDGNITWYRNGKVLQPV
EGEVAILFKKEIDPGTQLYTVTSSLEYKTTRSDIQMPFTCSVTYYGPSGQKTIYSEQEIF
DIYYPTEQVTIQVLPPKNAIKEGDNITLQCLGNGNPPPEEFMFYLPGQPEGIRSSNTYTL
TDVRRNATGDYKCSLIDKRNMAASTTITVHYLDLSLNPSGEVTKQIGDTLPVSCTISASR
NATVVWMKDNIRLRSSPSFSSLHYQDAGNYVCETALQEVEGLKKRESLTLIVEGKPQIKM
TKKTDPSGLSKTIICHVEGFPKPAIHWTITGSGSVINQTEESPYINGRYYSKIIISPEEN
VTLTCTAENQLERTVNSLNVSAISIPEHDEADDISDENREKVNDQAKLIVGIVVGLLLAA
LVAGVVYWLYMKKSKTASKHVNKDLGNMEENKKLEENNHKTEA
NT seq 1752 nt   +upstreamnt  +downstreamnt
atggcatctaaggtgtccccttcttgccgtctggttttctgcctcttgatctccgccgcg
gtcctcagaccaggccttggatggtacactgtcaactcagcatatggagacaccattgtc
atgccttgccgtctcgatgtacctcagaacctcatgtttggcaaatggaaatatgaaaag
cccgatgggtccccagtatttattgcattccgatcttctacgaagaaaagtgtgcagtat
gatgatgtcccagagtacaaggacagactgagcctctcagaaaactacactttgtctatc
gccaatgctaagatcagtgatgagaagagatttgtgtgcatgctagtgaccgaggacaat
gtgtttgaagcacctaccctagtcaaggtgttcaagcaaccatctaaacctgaaattgta
aacaaagcaccctttcttgaaacagatcagctgaaaaagttaggtgactgcatttcaaga
gacagttacccagatggcaacatcacatggtacaggaatggcaaagtgctgcaacctgtg
gaaggagaggtggccatactttttaaaaaggaaattgatccaggaactcagttgtatacc
gtgacttcctccttggagtacaagacaaccagatctgacatacaaatgccattcacctgt
tctgtgacatattatggaccctccggccagaaaacaatttattccgaacaagaaatcttt
gatatttactatcctacagagcaggtgacaatacaagtgctgccaccaaaaaatgccatc
aaagaaggggacaacatcacccttcagtgtttggggaatggcaacccacctcctgaggag
ttcatgttttacttaccaggacagcctgaaggcataagaagctcaaacacttacacactg
acagatgtgagacgcaatgccacaggggactacaaatgctcactcattgacaaaaggaac
atggcggcttcaacgaccatcacagttcactacttggatttatccttaaacccaagtggg
gaggtgaccaagcagattggcgataccctgcctgtgtcatgcacaatatctgcaagtagg
aacgcgactgtggtgtggatgaaggataacatccggctccggtccagcccttccttttcc
agtcttcattatcaggatgctgggaactatgtctgtgaaactgctcttcaggaggttgag
ggactgaagaaaagggagtcgctgaccctcattgtagaagggaaacctcaaatcaaaatg
actaagaaaactgaccccagtggactgtctaaaactataatctgccacgtggaagggttt
ccaaagccagctatacattggaccattaccggcagtgggagcgtcataaaccaaacagag
gagtctccttatattaatggcaggtattatagtaaaattatcatttcccctgaggagaat
gtaacattaacttgcacagcagaaaaccaactggagagaacagtaaactccctgaatgtc
tctgcgataagtattccagagcacgatgaggcagacgatataagtgatgaaaacagagaa
aaggtgaatgaccaggcaaaactgattgtgggaattgtcgttggtctcctcctcgctgcc
ctcgttgctggtgtcgtctactggctgtacatgaagaagtccaaaactgcatcaaaacat
gtaaacaaggaccttggtaatatggaggaaaataaaaagctggaagaaaacaatcacaaa
acagaagcctaa

DBGET integrated database retrieval system