KEGG   Mus musculus (mouse): 11666
Entry
11666             CDS       T01002                                 

Gene name
Abcd1, A, ALDP, Ald, Aldgh
Definition
(RefSeq) ATP-binding cassette, sub-family D (ALD), member 1
  KO
K05675  ATP-binding cassette, subfamily D (ALD), member 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu02010  ABC transporters
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    11666 (Abcd1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    11666 (Abcd1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    11666 (Abcd1)
Transporters [BR:mmu02000]
 ABC transporters, eukaryotic type
  ABCD (ALD) subfamily
   ABCD1 subgroup
    11666 (Abcd1)
SSDB
Motif
Pfam: ABC_membrane_2 ABC_tran AAA_21 AAA_29 AAA_23 Rad17 Adeno_IVa2 SMC_N AAA_16
Other DBs
NCBI-GeneID: 11666
NCBI-ProteinID: NP_031461
MGI: 1349215
Ensembl: ENSMUSG00000031378
Vega: OTTMUSG00000017700
UniProt: P48410
Position
X A7.3; X 37.39 cM
AA seq 736 aa
MPVLSTPRPSRVTTLKRTAVVLALTAYGVHKIYPLVRQCLTPARGPQVPAGEPTQEASGA
TATKAGMNRVFLQRLLALLRLLFPRVLCRETGLLALHSAALVSRTFLSVYVARLDGRLAR
CIVRKDPRAFSWQLLQWLLIALPATFINSAIRYLEGQLALSFRSRLVAHAYGLYFSQQTY
YRVSNMDGRLRNPDQSLTEDVVAFAASVAHLYSNLTKPLLDVAVTSYTLLRAARSRGAGT
AWPSAIAGLVVFLTANVLRAFSPKFGELVAEEARRKGELRYMHSRVVANSEEIAFYGGHE
VELALLQHSYQDLASQINLILLERLWYVMLEQFLMKYVWSASGLLMVAVPIITATGYAES
DSEAMKKAALEMKEEELVSERTEAFTIARNLLTAAADATERIMSSYKEVTELAGYTARVY
EMFQVFEDVKHCRFKRTGDLEEAQAGPGVMVQSGVHVEGPLKIQGQVVDVEQGIICENIP
IITPTGEVVVASLNIRVEEGMHLLITGPNGCGKSSLFRILGGLWPTYSGVLYKPPPQRMF
YIPQRPYMSVGSLRDQVIYPDSAEDMRRKGCSEQQLEAILGIVHLRHILQREGGWEAVCD
WKDVLSGGEKQRIGMARMFYHRPKYALLDECTSAVSIDVEGKIFQAAKDAGIALLSITHR
PSLWKYHTHLLQFDGEGGWKFEKLDSAARLSLTEEKQRLEQQLAGIPKMQGRLQELRQIL
GEAAAPVQPLVPGVPT
NT seq 2211 nt   +upstreamnt  +downstreamnt
atgccggtgctctccactccccggccctcacgggtgaccacgctgaagcgcacagctgtg
gtcctggccctcacagcctatggagtccacaaaatctaccctctagtacggcagtgtctg
actcctgccagaggtcctcaggtgccagctggggagcccactcaagaggcctctggagcc
accgcaaccaaggctggcatgaaccgggtattcctgcagcggctcttggcgctcctgagg
ctgctgttcccccgagtcttgtgccgggaaacagggctgctggccctgcattctgctgcc
ctggtaagccgaactttcctgtctgtgtatgttgcccgcctggacggcagactggcccgc
tgcattgtacgtaaggacccgcgggcctttagctggcaactgctgcagtggctcctcatc
gcccttcctgccactttcatcaacagtgccatccgctacctagagggccagctggctctt
tctttccgaagccgtctagtagctcatgcctatggactctacttctcccaacagacttac
taccgagtaagcaacatggatggacgacttcgaaaccctgatcagtctctgacagaggat
gtggtagcctttgctgcctctgtagcccacctttattccaacctgaccaagccactcctg
gatgtggctgtgacctcctacactctccttcgagctgcccgatcccgaggagctggcaca
gcctggccctcagccatcgctggcctggtggtgttcctcacagccaacgtgcttcgagcc
ttctctcccaagtttggggagctagtggcagaggaggcacggcgaaagggggaactgcgc
tacatgcactctcgagtggtggccaactcagaggaaattgccttctacgggggccatgag
gtggaactggcactactacagcactcctatcaagacctagcttcacagatcaacctcatc
ctgcttgagcgcctatggtatgtcatgctggaacagttcctcatgaaatatgtgtggagt
gcatctggcctgctcatggtagctgtccccatcatcacagccactggctatgcagagtca
gactcagaagccatgaagaaggcagccttggaaatgaaggaagaggagctggttagtgag
cgtacagaagctttcaccattgcccgaaacctcctcacagctgctgcagatgccaccgaa
aggatcatgtcatcttataaggaggtgacagagctggctggctacacagccagggtgtac
gagatgttccaggtatttgaagatgtcaaacactgtcgttttaagaggacaggagatcta
gaggaggctcaggctgggcctggggtcatggtacagtctggtgtccatgtagaggggccc
ctgaagatccaaggccaagttgtggatgtggagcaggggatcatctgtgagaacatccct
atcatcacacccactggagaggtggtggtggccagcctcaacatcagggtggaggaaggc
atgcacctgctcatcacaggccccaatggctgtggcaagagttctctgttccgaatccta
ggtggactctggcccacatacagtggtgtactctataagcccccaccccagcgcatgttc
tatatccctcagaggccctacatgtccgtgggctccttgcgtgaccaagtgatctatccc
gactctgcggaagacatgcggaggaagggctgctcggagcagcagctggaagcaatcctg
ggcatcgtgcatctccgccacatcctgcaacgggagggaggttgggaggcagtgtgtgac
tggaaggacgtcctgtctggaggtgagaagcagaggattggtatggcgcgcatgttctac
cacaggcccaagtacgccctcctggatgagtgcactagtgccgtgagcattgatgtggaa
ggcaagatcttccaagcagccaaagatgctggtatcgcactgctctccatcacccatcga
ccctccctatggaagtaccacacacacttgctgcagtttgatggggaaggaggctggaag
tttgagaagctggattctgctgcccgcctgagcctgactgaagagaagcagcgcctggag
cagcaactggcgggcatccccaagatgcaggggcgccttcaggagctccgccagatcctt
ggcgaagctgcagctccagttcaacccctggtcccaggagtccccacttga

KEGG   Mus musculus (mouse): 19299
Entry
19299             CDS       T01002                                 

Gene name
Abcd3, AI313901, AU018866, AW146054, PMP, PMP68, PMP70, Pxm, Pxmp1
Definition
(RefSeq) ATP-binding cassette, sub-family D (ALD), member 3
  KO
K05677  ATP-binding cassette, subfamily D (ALD), member 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu02010  ABC transporters
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    19299 (Abcd3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    19299 (Abcd3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    19299 (Abcd3)
Transporters [BR:mmu02000]
 ABC transporters, eukaryotic type
  ABCD (ALD) subfamily
   ABCD3 subgroup
    19299 (Abcd3)
SSDB
Motif
Pfam: ABC_membrane_2 ABC_tran AAA_23 SMC_N AAA_29 Rad17 AAA_21 AAA_16 AAA_27 AAA_18 AAA_5
Other DBs
NCBI-GeneID: 19299
NCBI-ProteinID: NP_033017
MGI: 1349216
Ensembl: ENSMUSG00000028127
Vega: OTTMUSG00000031086
UniProt: P55096
Position
3 G1; 3 52.94 cM
AA seq 659 aa
MAAFSKYLTARNTSLAGAAFLLLCLLHKRRRALGLHGKKSGKPPLQNNEKEGKKERAVVD
KVFLSRLSQILKIMVPRTFCKETGYLLLIAVMLVSRTYCDVWMIQNGTLIESGIIGRSSK
DFKRYLFNFIAAMPLISLVNNFLKYGLNELKLCFRVRLTRYLYEEYLQAFTYYKMGNLDN
RIANPDQLLTQDVEKFCNSVVDLYSNLSKPFLDIVLYIFKLTSAIGAQGPASMMAYLLVS
GLFLTRLRRPIGKMTIMEQKYEGEYRYVNSRLITNSEEIAFYNGNKREKQTIHSVFRKLV
EHLHNFIFFRFSMGFIDSIIAKYVATVVGYLVVSRPFLDLAHPRHLHSTHSELLEDYYQS
GRMLLRMSQALGRIVLAGREMTRLAGFTARITELMQVLKDLNHGRYERTMVSQQEKGIEG
AQASPLVPGAGEIINTDNIIKFDHVPLATPNGDILIQDLSFEVRSGANVLICGPNGCGKS
SLFRVLGELWPLFGGRLTKPERGKLFYVPQRPYMTLGTLRDQVIYPDGKEDQKKRGISDQ
VLKEYLDNVQLGHILEREGGWDSVQDWMDVLSGGEKQRMAMARLFYHKPQFAILDECTSA
VSVDVEDYIYSHCRKVGITLFTVSHRKSLWKHHEYYLHMDGRGNYEFKKITEDTVEFGS
NT seq 1980 nt   +upstreamnt  +downstreamnt
atggcggccttcagcaagtacttgacggcacggaacacctcgctggcgggggccgcgttc
ctgctgctctgcctactccataagcggcgtcgcgccctcggcctgcacggtaagaaaagt
ggaaaaccgccattacagaataatgagaaagaaggaaagaaagagcgagctgtggtggac
aaagtgtttttatcaaggctctcacagatcctaaaaattatggttcctagaacattttgt
aaagagacaggctacttgttacttattgcggttatgctggtatctcgaacatactgtgat
gtttggatgattcagaatgggacgctcattgagagtggcatcattggtcgcagcagcaaa
gatttcaagagatacttattcaacttcatcgctgccatgcctcttatctctctggttaat
aacttcttgaagtatgggttaaatgagctcaaactgtgcttccgagtcaggctcacacgg
tacctctacgaggagtatctccaagctttcacctattataaaatgggcaacctggataac
agaatagcaaatccagaccagctgcttacacaggatgtagaaaaattttgtaacagtgta
gtcgatctgtattcaaatcttagtaagccatttttagacatagttttatatattttcaag
ttaacaagtgcaattggagctcagggcccggcaagcatgatggcctacttgcttgtttct
gggctattcctaactcgactcagaagacccattggtaagatgacaattatggagcagaag
tacgaaggagaatacagatacgtgaattcacggcttatcactaatagtgaagaaattgcc
ttttacaatgggaataaacgggagaagcagacaatccactcagtcttccgaaaactggtg
gaacacctacataatttcattttctttcggttttctatgggtttcattgatagcatcatt
gccaaatatgttgccactgtcgtcgggtacctggttgtcagtcgccccttcctagatctg
gcacaccctcgccaccttcacagcacacactcagagctgctggaggattactaccaaagt
ggaaggatgcttttgagaatgtctcaagctttgggtcgtatagttttggctgggcgtgaa
atgactagattggctggttttacggctcggattacagaattaatgcaagtactaaaggac
ttaaatcatggcagatatgaacgtacaatggtgtcacaacaggagaagggtattgaagga
gcacaagctagtcccttggtccctggtgctggagaaatcatcaatacagacaacattata
aagtttgatcatgttcctttagcaacaccaaatggtgacatcttgatccaagaccttagt
tttgaagttcgatctggggccaacgttctgatttgtggtccaaacggctgtggaaagagc
tccctcttccgtgttcttggtgagttatggcctctttttggagggcggcttactaaacct
gagagaggaaagttattttatgttcctcagcgaccctatatgaccctgggaacactgaga
gaccaagtcatatatccagatggaaaggaagatcagaagaagagggggatctctgaccag
gtgctgaaggagtacttggacaatgtgcagctgggtcacatccttgagcgagaaggcggc
tgggacagtgttcaggactggatggatgtactcagcggaggagagaaacaaagaatggcg
atggcaagactgttttatcataaaccccagtttgccattttggatgaatgcacaagtgcg
gtcagtgtggatgtggaggactacatttacagccactgtcgaaaggttggcatcaccctc
tttaccgtttcacacagaaagtccctttggaagcaccacgagtactacctgcatatggat
gggagaggcaattatgaattcaaaaagatcacagaagatacagttgagttcggatcatag

KEGG   Mus musculus (mouse): 19300
Entry
19300             CDS       T01002                                 

Gene name
Abcd4, P6, P69r, P70R, Pxm, Pxmp1l
Definition
(RefSeq) ATP-binding cassette, sub-family D (ALD), member 4
  KO
K05678  ATP-binding cassette, subfamily D (ALD), member 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu02010  ABC transporters
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    19300 (Abcd4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    19300 (Abcd4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    19300 (Abcd4)
Transporters [BR:mmu02000]
 ABC transporters, eukaryotic type
  ABCD (ALD) subfamily
   ABCD4 subgroup
    19300 (Abcd4)
SSDB
Motif
Pfam: ABC_membrane_2 ABC_tran AAA_30 AAA_22 IRK AAA_16 DEAD DLIC AAA_29 AAA_23 T2SSE
Other DBs
NCBI-GeneID: 19300
NCBI-ProteinID: NP_033018
MGI: 1349217
Ensembl: ENSMUSG00000021240
UniProt: O89016
Position
12 D1; 12 39.3 cM
AA seq 606 aa
MAVPGPTARAGARPRLDLQLVQRFVRIQKVFFPSWSSQNVLMFMTLLCVTLLEQLVIYQV
GLIPSQYYGVLGNKDLDGFKALTLLAVTLIVLNSTLKSFDQFTCNLLYVSWRKDLTEHLH
HLYFRARVYYTLNVLRDDIDNPDQRISQDVERFCRQLSSVTSKLIISPFTLTYYTYQCFQ
STGWLGPVSIFGYFIVGTMVNKTLMGPIVTKLVQQEKLEGDFRFKHMQIRVNAEPAAFYR
AGLVEHMRTDRRLQRLLQTQRELMSRELWLYIGINTFDYLGSILSYVVIAIPIFSGVYGD
LSPTELSTLVSKNAFVCIYLISCFTQLIDLSTTLSDVAGYTHRIGELQEALLDMSRKSQD
CEALGESEWDLDKTPGCPTTEPSDTAFLLDRVSILAPSSDKPLIKDLSLKICEGQSLLIT
GNTGTGKTSLLRVLGGLWEGMKGSVQMLADFGPHGVLFLPQKPFFTDGTLREQVIYPLKE
IYPDSGSADDERIVRFLELAGLSSLVARTGGLDQQVDWNWYDVLSPGEMQRLSFARLFYL
QPKYAVLDEATSALTEEAESELYRIGQQLGMTFISVGHRPSLEKFHSWVLRLHGGGSWEL
TRIKLE
NT seq 1821 nt   +upstreamnt  +downstreamnt
atggcggtcccgggacccacggcccgagctggtgccaggcccagattagatctgcaactt
gtccagaggttcgtgaggatacagaaggttttctttccttcttggtcatcacagaatgtc
ttaatgttcatgacgctcttgtgcgtgaccctcctggagcaactggtgatctaccaagtt
ggcttgatccccagtcagtattatggagtcttgggaaacaaagacctggatggatttaag
gcactgaccttgctggccgtgacacttattgtcctcaactccaccctgaagagctttgac
cagttcacctgcaacctgctgtacgtgagctggaggaaggacctcacggagcacctgcac
cacctgtacttccgggcccgcgtgtactacaccctcaacgtgctgcgggacgacattgat
aatccggaccagcgaatcagccaggatgtggagcgattctgccgccagctcagcagcgtg
accagcaagctgatcatttcccccttcactcttacctactacacttaccagtgcttccaa
agcacaggctggctcgggcctgtgagcatctttggatatttcatcgtggggaccatggtg
aacaaaactttgatggggcccatcgtgacgaagctggtgcagcaggagaagctggagggg
gattttaggttcaagcacatgcagattcgagtgaatgcagagcctgcggctttctataga
gctgggctcgtcgagcacatgaggacagaccgcaggctgcagagactccttcagacccag
agagagctgatgtccagggagctctggctgtacattggtatcaacacctttgactatctg
ggcagcatcctgagttatgtcgtcatcgctatccccattttcagtggggtctatggagat
ttgagccccacagagcttagcaccctggtcagcaagaatgcctttgtgtgcatctacctc
atcagctgcttcacccagctcattgacctgtccaccacactctcggatgttgccggttac
acacacaggattggagagcttcaggaggccctgctggacatgtcccgaaaatcacaagac
tgtgaagccctaggcgagagtgagtgggacttggacaaaaccccagggtgtccaacaaca
gagccatcagacacagcttttctgctcgatcgggtttccatattggccccctcctctgac
aagcccctgatcaaggacttgagcttgaagatctgtgaggggcagagtctgctcatcaca
ggcaacacgggcactggcaagacctccctgctgcgggtgctgggaggcctgtgggagggc
atgaaaggctcagtgcagatgctggctgattttgggccccacggggtgctgttcctgcct
cagaagccattcttcactgatgggacacttcgggagcaggtgatatatcccctgaaggag
atctaccctgactcaggttctgcggacgatgagaggattgtgaggttcttggaattggca
ggcctgtccagcttggtggcaaggactggaggtctggaccagcaggtggattggaactgg
tatgatgtcctgtccccaggggagatgcaaagactctccttcgcccgtctcttctacctg
cagcccaagtatgcagtgctcgatgaagccaccagtgccctgacagaggaagcagagagt
gagctctaccgaattggtcagcaactggggatgacatttatcagcgtgggacatcgtccc
agccttgagaagtttcactcctgggttctgagactccacggaggaggaagctgggagctg
actagaatcaaactggaatga

KEGG   Mus musculus (mouse): 26874
Entry
26874             CDS       T01002                                 

Gene name
Abcd2, A, ABC3, ABC39, AL, ALDL1, ALDR, ALDRP
Definition
(RefSeq) ATP-binding cassette, sub-family D (ALD), member 2
  KO
K05676  ATP-binding cassette, subfamily D (ALD), member 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu02010  ABC transporters
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    26874 (Abcd2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    26874 (Abcd2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    26874 (Abcd2)
Transporters [BR:mmu02000]
 ABC transporters, eukaryotic type
  ABCD (ALD) subfamily
   ABCD2 subgroup
    26874 (Abcd2)
SSDB
Motif
Pfam: ABC_membrane_2 ABC_tran AAA_21 AAA_23 AAA_29 Rad17 RVP SMC_N ARID AAA_27 Adeno_IVa2
Other DBs
NCBI-GeneID: 26874
NCBI-ProteinID: NP_036124
MGI: 1349467
Ensembl: ENSMUSG00000055782
UniProt: Q61285 A0A0R4J0U5
Position
15; 15 E3
AA seq 741 aa
MIHMLNAAAYRVKWTRSGAAKRAACLVAAAYALKTLYPIIGKRLKQPGHRKAKAEAYSPA
ENREILHCTEIICKKPAPGLNAAFFKQLLELRKILFPKLVTTETGWLCLHSVALISRTFL
SIYVAGLDGKIVKSIVEKKPRTFIIKLIKWLMIAIPATFVNSAIRYLECKLALAFRTRLV
DHAYETYFANQTYYKVINMDGRLANPDQSLTEDIMMFSQSVAHLYSNLTKPILDVILTSY
TLIRTATSRGASPIGPTLLAGLVVYATAKVLKACSPKFGSLVAEEAHRKGYLRYVHSRII
ANVEEIAFYRGHKVEMKQLQKCYKALAYQMNLILSKRLWYIMIEQFLMKYVWSSCGLIMV
AIPIITATGFADGDLEDGPKQAMVSDRTEAFTTARNLLASGADAIERIMSSYKEITELAG
YTARVYNMFWVFDEVKRGIYKRTVTQEPENHSKRGGNLELPLSDTLAIKGTVIDVDHGII
CENVPIITPAGEVVASRLNFKVEEGMHLLITGPNGCGKSSLFRILSGLWPVYEGVLYKPP
PQHMFYIPQRPYMSLGSLRDQVIYPDSADDMREKGYTDQDLERILHSVHLYHIVQREGGW
DAVMDWKDVLSGGEKQRMGMARMFYHKPKYALLDECTSAVSIDVEGKIFQAAIGAGISLL
SITHRPSLWKYHTHLLQFDGEGGWRFEQLDTAIRLTLSEEKQKLESQLAGIPKMQQRLNE
LCKILGEDSVLKTIQTAEKTS
NT seq 2226 nt   +upstreamnt  +downstreamnt
atgatacacatgctaaatgcagcagcctatcgggtgaaatggaccagatccggtgctgct
aaaagggctgcctgcctggtggctgcggcatatgctctgaaaaccctctatcccatcatt
ggcaagcgtttaaagcagcctggccacaggaaggcaaaagcagaagcttactcgcctgca
gagaacagagaaatactgcattgcacggagatcatctgtaaaaaacctgcgccgggacta
aatgcagcttttttcaaacagctactagaacttcggaaaatcctctttccaaaacttgtg
accactgaaacggggtggctctgcctccactcggtggctctaatctcaagaacatttctc
tctatttatgtggctggtctggatgggaaaatcgtgaaaagcatcgtggaaaagaagcct
cggactttcatcatcaaattaatcaagtggcttatgattgctatccctgctacctttgtc
aacagtgctatcaggtacctggaatgcaaactggcattggcctttagaactcgcttagta
gaccatgcctatgagacctatttcgcaaatcagacttattataaggtgataaatatggat
gggaggctggcaaaccctgaccagtctcttaccgaagacattatgatgttctcgcaatct
gtggctcacctgtattccaaccttaccaaacctattttagatgtcattctaacctcctat
actctcatccggacagctacatccagaggagcaagccctatagggcccaccctgttagca
ggacttgtcgtgtatgccactgctaaagtactgaaagcttgctcgcccaaatttggttcg
ctggtggctgaagaagcccacaggaaaggctacctgcggtatgtccactcccgaatcata
gccaatgtagaagaaattgccttctacagaggacataaggtagaaatgaagcagctgcag
aaatgttacaaggctttagcttaccagatgaacctgattttatccaaacgtttatggtac
atcatgatagaacaattcttgatgaagtatgtgtggagcagctgtggactaattatggtg
gctatacccattatcactgcaacgggctttgcagatggtgatctggaggatggtccaaag
caggctatggttagcgatcggacagaggccttcaccactgcccggaacttactggcctct
ggagctgatgcaattgaaaggattatgtcttcatacaaagagatcactgaactagcaggt
tatactgctagagtatacaatatgttctgggtcttcgatgaagtgaagagaggcatttat
aagagaactgtcactcaggaacctgaaaaccatagcaagcgtggaggtaacctggaacta
cccctcagcgacaccctggccatcaaaggaacagttattgatgtggatcatggaatcatt
tgtgaaaatgttcccataattacaccagcgggcgaagtggtggcttccaggctaaacttc
aaagtggaagaagggatgcatctcttgataactggtcccaacggttgtgggaaaagctct
ctcttcagaatcttaagcgggctgtggcctgtgtatgaaggagtcctttataaaccgcct
ccccaacatatgttctatattccacagaggccatacatgtctcttggaagtctccgggat
caagtaatttaccctgactcagcggatgacatgcgtgagaaaggttacactgaccaagac
ctagaacgcatcctgcacagcgtgcacctctaccacatagttcaaagagaaggaggatgg
gatgcagtcatggactggaaagatgtcctttccggaggggagaagcagagaatgggcatg
gcgcggatgttttaccataaaccgaagtatgcattgctggatgaatgtaccagtgccgtg
agcatcgacgttgaaggaaagatatttcaggctgctattggggctgggatttccctactc
tccataacacacaggccttctctgtggaaataccacactcatctattacaattcgatggc
gaaggaggctggcgctttgaacagttggacactgctatccgtttaacgttgagtgaggaa
aagcaaaagttggagtcgcagctcgctggaattcccaaaatgcaacagagactcaacgaa
ctatgcaaaattctgggggaagactcggtgctgaaaacaatccaaactgcagaaaagaca
tcctaa

DBGET integrated database retrieval system