KEGG   Mus musculus (mouse): 11668Help
Entry
11668             CDS       T01002                                 

Gene name
Aldh1a1, ALDH-E1, ALHDII, Ahd-2, Ahd2, Aldh1, Aldh1a2, E1, Raldh1
Definition
(RefSeq) aldehyde dehydrogenase family 1, subfamily A1
  KO
K07249  retinal dehydrogenase [EC:1.2.1.36]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00830  Retinol metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    11668 (Aldh1a1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.36  retinal dehydrogenase
     11668 (Aldh1a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh LuxC DUF1487
Motif
Other DBs
NCBI-GeneID: 11668
NCBI-ProteinID: NP_038495
MGI: 1353450
Ensembl: ENSMUSG00000053279
Vega: OTTMUSG00000021238
UniProt: P24549
Position
19 B; 19 13.91 cM
AA seq 501 aa AA seqDB search
MSSPAQPAVPAPLADLKIQHTKIFINNEWHNSVSGKKFPVLNPATEEVICHVEEGDKADV
DKAVKAARQAFQIGSPWRTMDASERGRLLNKLADLMERDRLLLATMEALNGGKVFANAYL
SDLGGCIKALKYCAGWADKIHGQTIPSDGDIFTYTRREPIGVCGQIIPWNFPMLMFIWKI
GPALSCGNTVVVKPAEQTPLTALHLASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDVD
KVAFTGSTQVGKLIKEAAGKSNLKRVTLELGGKSPCIVFADADLDIAVEFAHHGVFYHQG
QCCVAASRIFVEESVYDEFVKRSVERAKKYVLGNPLTPGINQGPQIDKEQHDKILDLIES
GKKEGAKLECGGGRWGNKGFFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSVDDVIKR
ANNTTYGLAAGLFTKDLDKAITVSSALQAGVVWVNCYMMLSAQCPFGGFKMSGNGRELGE
HGLYEYTELKTVAMKISQKNS
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcgcctgcacaacctgcagtccctgccccactggccgacttgaagattcaacat
accaagatcttcataaacaatgaatggcacaattcagtgagcggcaagaaatttccagtt
cttaaccctgcaactgaggaggtcatctgccacgtggaagaaggggacaaggctgatgtt
gacaaagctgtgaaggctgcaagacaggctttccagattggctctccatggcgcaccatg
gatgcttcagagaggggccgcctgctgaacaagctggctgacttaatggagagagatcgt
ctgctgctggctacaatggaggcactcaatggtgggaaagtctttgccaatgcatacttg
tcggatttaggaggctgcataaaagcattaaagtactgtgcaggctgggctgacaagatt
catggtcaaacaataccaagtgatggagacattttcacttatacaagacgtgaacctatt
ggagtgtgtggccaaatcatcccctggaattttccaatgctcatgttcatttggaagata
ggccctgcccttagctgtgggaataccgtggttgtcaagccagcagagcaaactcctctc
acggctcttcacctggcatctttaataaaagaggcagggtttcctcctggcgtggtaaac
attgtccctggttatgggccaactgcaggggcagccatctcctctcacatggatgtcgac
aaggtggccttcactggatcaacacaggttggcaagttaatcaaggaagctgcagggaaa
agcaatctgaagagagtcaccctggagctggggggaaagagcccttgcattgtgtttgca
gatgccgacttggacattgctgttgagtttgcacaccatggagtgttttatcatcaaggc
caatgttgtgtcgcagcatcccggatttttgttgaggagtcagtttatgatgagtttgtg
aaaaggagtgttgagcgagctaagaaatatgttcttggaaatcctctgaccccaggaata
aatcaaggccctcagattgacaaggaacaacatgataaaatactcgatctcattgagagt
gggaagaaagaaggagccaaactggagtgtggtggaggacgctgggggaacaaaggcttc
tttgtgcagcccacagtgttctccaacgtgactgatgagatgcgcattgccaaagaggag
atatttggaccagtgcaacaaatcatgaagtttaagtctgtagatgatgtgatcaagaga
gcaaacaatactacctatggtttagcagcaggactcttcactaaagacctggataaggcc
atcactgtgtcatctgctctgcaggctggggtggtgtgggttaactgctatatgatgttg
tcagcccagtgccccttcggtggattcaagatgtctggaaatggaagagaactgggtgaa
catggtctttatgaatacactgagctcaagacagtcgcaatgaagatatctcagaagaac
tcctaa

DBGET integrated database retrieval system