KEGG   Mus musculus (mouse): 11671
Entry
11671             CDS       T01002                                 

Symbol
Aldh3a2, AI194803, Ahd-3, Ahd-3r, Ahd3, Ahd3-r, Aldh4, Aldh4-r, FALDH
Name
(RefSeq) aldehyde dehydrogenase family 3, subfamily A2
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu00053  Ascorbate and aldarate metabolism
mmu00071  Fatty acid degradation
mmu00280  Valine, leucine and isoleucine degradation
mmu00310  Lysine degradation
mmu00330  Arginine and proline metabolism
mmu00340  Histidine metabolism
mmu00380  Tryptophan metabolism
mmu00410  beta-Alanine metabolism
mmu00561  Glycerolipid metabolism
mmu00620  Pyruvate metabolism
mmu00770  Pantothenate and CoA biosynthesis
mmu01100  Metabolic pathways
mmu01240  Biosynthesis of cofactors
mmu04936  Alcoholic liver disease
Module
mmu_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    11671 (Aldh3a2)
   00053 Ascorbate and aldarate metabolism
    11671 (Aldh3a2)
   00620 Pyruvate metabolism
    11671 (Aldh3a2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    11671 (Aldh3a2)
   00561 Glycerolipid metabolism
    11671 (Aldh3a2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    11671 (Aldh3a2)
   00310 Lysine degradation
    11671 (Aldh3a2)
   00330 Arginine and proline metabolism
    11671 (Aldh3a2)
   00340 Histidine metabolism
    11671 (Aldh3a2)
   00380 Tryptophan metabolism
    11671 (Aldh3a2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    11671 (Aldh3a2)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    11671 (Aldh3a2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    11671 (Aldh3a2)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     11671 (Aldh3a2)
SSDB
Motif
Pfam: Aldedh LuxC Pam17
Other DBs
NCBI-GeneID: 11671
NCBI-ProteinID: NP_031463
MGI: 1353452
Ensembl: ENSMUSG00000010025
Vega: OTTMUSG00000005829
UniProt: P47740
Position
11:complement(61114243..61158354)
AA seq 484 aa
MERQVLRLRQAFRSGRSRPLRFRLQQLEALRRMVQEREKEILAAIAADLSKSELNAYSHE
VITILGEIDFMLGNLPELASARPAKKNLLTMMDEAYVQPEPLGVVLIIGAWNYPFVLTMQ
PLVGAIAAGNAAIVKPSELSENTAKILAELLPQYLDQDLYAIVNGGIPETTELLKQRFDH
ILYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDRDCDLDVACRRIAWGKYMNCGQT
CIAPDYILCEASLQNQIVQKIKETVKDFYGENIKASPDYERIINLRHFKRLQSLLKGQKI
AFGGEMDEATRYLAPTILTDVDPNSKVMQEEIFGPILPIVSVKNVDEAINFINDREKPLA
LYVFSRNNKLIKRVIDETSSGGVTGNDVIMHFTVNSLPFGGVGASGMGAYHGKYSFDTFS
HQRPCLLKGLKGESVNKLRYPPNSESKVSWAKFFLLKQFNKGRLGMLLFVCLVAVAAVIV
KDQL
NT seq 1455 nt   +upstreamnt  +downstreamnt
atggagcgccaggtcctacggcttcgccaggcgttccggtccggccgatctcggccgctg
cgcttccgattgcagcagcttgaggccctgcggaggatggtgcaagagcgcgagaaggaa
atcttagcagccatcgcggcagacctgagcaaaagtgaactcaatgcatacagtcatgaa
gtcattaccatccttggagagattgattttatgttggggaatcttcctgaattggcttct
gcgagaccggctaagaagaacctgctaaccatgatggatgaggcctacgttcagcccgag
cctctgggagtcgtactgattattggagcttggaattaccctttcgttcttaccatgcaa
ccgctggtgggagccattgctgcaggaaatgctgccattgttaagccctcagaactcagt
gaaaacacggccaagatcttggctgaactcctccctcagtacttagaccaggacctgtat
gcgattgttaatggcggtatcccggaaaccacggagcttctgaagcagcggtttgaccac
attctctatacagggaacactgcagttggaaaaattgtcatggaagctgctgccaagcat
ctgacccctgtgaccctggaactcggcgggaaaagcccttgttacattgacagagactgt
gatctggacgtggcttgcagacgcatagcctggggaaagtacatgaattgtggtcaaacc
tgcattgctcctgactatatcctgtgcgaagcctccctccagaatcaaatcgtacagaag
attaaggaaacggtgaaggacttttatggggaaaacataaaggcttctcctgactatgaa
aggatcatcaatcttcgtcactttaagaggttacaaagtctgcttaaaggccagaaaata
gctttcggtggagagatggatgaggccacacgctacttagccccaaccatacttacagat
gttgatcctaactccaaggtgatgcaagaagaaatttttggaccaattcttccaatagtg
tctgtgaaaaatgtagacgaagccataaatttcataaatgaccgtgaaaagcccctggct
ctctacgtattttctcgtaacaataagctcatcaaacgggtgatagatgagacctccagt
ggtggagtcaccggcaatgatgtcatcatgcacttcactgttaattctctgccctttgga
ggtgtgggtgccagtggaatgggggcgtatcatggaaaatacagttttgataccttttct
catcagcgcccctgcttgttaaaagggttaaagggggaaagcgtcaacaagctcaggtac
ccgcccaacagcgagtccaaggtcagctgggccaagttcttcctgctgaagcagttcaac
aaaggaaggctggggatgctgttgtttgtgtgcctggttgctgttgcagctgtgattgtc
aaggatcagctgtaa

DBGET integrated database retrieval system