KEGG   Mus musculus (house mouse): 116731
Entry
116731            CDS       T01002                                 
Symbol
Pcdha1, CNR
Name
(RefSeq) protocadherin alpha 1
  KO
K16493  protocadherin alpha
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    116731 (Pcdha1)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    116731 (Pcdha1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation proteins
   Other centriole associated proteins
    116731 (Pcdha1)
Cell adhesion molecules [BR:mmu04515]
 Cadherins
  Protocadherins
   116731 (Pcdha1)
SSDB
Motif
Pfam: Cadherin Cadherin_tail Cadherin_2 Cadherin_C_2
Other DBs
NCBI-GeneID: 116731
NCBI-ProteinID: NP_473413
MGI: 2150982
Ensembl: ENSMUSG00000103442
UniProt: Q91Y21
Position
18:37063338..37320710
AA seq 948 aa
MLFSRLRGLRARRLLLFSLLFLAAWEAGSGQIHYSVPEEAKHGTFVGRIAQDLGLELTEL
VPRLFRVASKDRGDLLEVNLQNGILFVNSRIDREELCGRSAECSIHLEVIVDRPLQVFHV
EVKVKDINDNPPVFKGAEQRIFIPENRQLDSRFPLEGAVDADIGANSLLTYTLSPTDYFS
LKVETTDELSKSLSLELRKSLDREETPELQLLLTATDGGKPELEGTVRLQITVLDVNDNA
PLFDQAIYRAQLVESTVNGTLVTTLNATDADEGVNGEVVFSFGNDVSLDIQEKFNVDSLS
GEIRVIGDLDYEKTKSYEIQIKAVDKGTPSMSNHCKVLVKVLDINDNAPELSITSLSLPI
KEDTPLNTIIALIKVSDIDSGVNGQVTCSLTPHVPFKLVSTFKNYYSLVLDSTLDRETTA
DYKVVVTARDGGSPSLWATASVSVEVADVNDNAPVFAQPEYTVFVKENNPPGAHIFTVSA
MDADAQENALVSYSLVERRVGERLLSSYVSVHAESGKVFALQPLDHEELELLQFQVSARD
AGVPALGSNVTLQVFVLDENDNPPTLLGPHAGSAVSELVSRTMGAGHVVTKVRAVDADSG
YNAWLSYELQPPTGGARNPFRVGLYTGEISTTRSLDEVDVPRQRLLVLVKDHGEPMLTAT
ATVLVSLVESSPIQKASLPVLTGAVGSKASLVDVNVYLIIAICAVSSLLVLTLLLYTALR
CSATPTDGACGPGKPMLVCSSAVGSWSYSQQRRQKVCSGEGPPKTDLMAFSPGLAPGLNI
AERSDHAEVNSDLSGNPRQPNPDWRYSASLRAGMHSSVHLEEAGILRAGPGGPDQQWPTV
SSATPEPEAGEVSPPVGAGVNSNSWTFKYGPGNPKQSGPGELPDKFIIPGSPAIISIRQE
PANNQIDKSDFITFGKKEETKKKKKKKKGNKTQEKKEKGNSTTDNSDQ
NT seq 2847 nt   +upstreamnt  +downstreamnt
atgctgttttccaggctccgaggcctgagagcccggcgcctgctcttgttctcgcttctg
tttcttgcagcctgggaggcagggagcggccagattcattactctgtcccagaggaagcc
aaacacggcacctttgtgggccgcatcgcgcaggacctggggctggagctgacggagctg
gtgccccgcctattcagggtggcgtccaaggatcgcggggaccttctggaggtaaatctg
cagaatggcattttgtttgtgaattctcggatcgaccgggaggagctgtgcgggcggagc
gcggagtgtagcatccacctggaggtgatcgtggacaggccgctgcaggttttccacgtg
gaggtgaaggttaaagatattaatgataacccaccagttttcaaaggcgcagagcaaagg
atatttattcctgaaaacagacaactagattcacggtttccactagagggcgccgtggac
gcagacattggtgccaattctcttttaacttacacgctgagccccactgattacttttct
ttaaaggtagagacaacagacgaactcagtaaatccctttcgcttgaactgagaaaatct
ttggatagagaagaaacaccagaacttcagttattactgacagccaccgacgggggcaag
ccagagctggaggggacagttcggctgcagattactgtgctcgatgttaatgacaacgcc
ccactgtttgaccaggccatctacagagcacagttagtagaatctacagtgaatgggaca
ttagtgacgacgttaaatgccactgacgctgatgaaggtgttaatggtgaagttgtgttt
tcctttggcaatgacgtttctcttgacattcaagaaaaattcaatgtggattctctttca
ggagaaattagagtgatcggtgatctagattatgaaaaaacaaaatcctatgaaattcaa
ataaaggcagttgataaagggactccctccatgtcaaatcactgcaaggttttggtgaaa
gtactggatataaatgataatgctccagagctgtcgatcacatccttgtctttgcccatc
aaagaggatactccacttaacactatcatcgcactcatcaaggtgtccgacatcgactca
ggtgtcaacgggcaggtgacctgctccctaactcctcatgtccctttcaagttggtgtcc
accttcaagaattactattcgcttgtgctggacagcaccctggaccgagagaccacagcg
gactataaggtggtggtgacagcccgcgacgggggctcgccctcgctgtgggccacggcc
agcgtgtctgtggaggtggctgacgtgaacgacaatgctccagtgttcgcgcagcccgaa
tacactgtgttcgtgaaggagaacaacccgcctggtgcgcacatcttcacggtgtcagcg
atggacgcggatgcgcaggagaatgcgctggtgtcctactcgctggtggagcggagggtg
ggcgagcgcttgctgtcgagctatgtgtctgtgcacgcggagagcggcaaggtgttcgcg
ctgcagcctctggaccatgaggagctggagctgctgcagttccaggtgagcgcgcgggat
gctggtgtgcctgccctgggcagcaatgtgactctgcaggtgtttgtgctggacgagaat
gacaatccacccacactgctggggcctcacgcaggcagcgcagtgagcgaactggtgtca
cggacaatgggtgcagggcatgtggtgacaaaggtgcgcgcggtggacgcggactctggc
tacaatgcgtggctgtcctatgaactacaacctcctacaggtggtgcgcgcaacccgttt
cgcgtgggtctgtacactggtgagattagcaccacacgctccttagatgaggtcgatgtt
ccacgacagcgtctcttggtgctggtgaaggaccatggagagccaatgctgactgctacc
gctaccgtgttggtatctctggtggaaagcagtccgattcagaaagcctctttgcctgta
ttaaccggtgcagtgggttccaaggcatcgctggtggatgtcaacgtgtacctgatcatc
gccatctgtgccgtgtccagcctgttagtgctcactttgcttctgtacacagcgctgcgc
tgctccgcgacacccactgatggagcctgtggtccggggaagcccatgctggtgtgctcc
agcgcggtggggagctggtcatactcgcagcagaggcgacagaaggtgtgctctggagag
ggtccacctaagaccgacctcatggccttcagcccgggtttagccccaggtttgaacata
gcggaaagaagtgaccacgcagaagtaaattcagatctttctggtaatccccggcagccc
aaccctgactggcgctactctgcctcgctaagagcaggcatgcacagctctgtgcacctg
gaggaggctggcattctacgggctggtccaggagggcctgatcagcagtggccaacagta
tccagtgcaacaccagaacctgaggcaggagaggtgtcccctccggtgggcgccggtgtc
aacagcaacagctggacctttaaatacggaccaggcaaccccaaacagtccggtcccggt
gagttgccagacaaattcattatcccaggatctcctgcaatcatctccatccggcaggag
cctgctaacaaccaaattgacaaaagcgattttataaccttcggcaaaaaggaggagacc
aagaaaaagaagaaaaagaagaagggtaacaagacccaggagaaaaaagagaaagggaac
agcacgacggacaacagtgaccagtga

DBGET integrated database retrieval system