KEGG   Mus musculus (house mouse): 116748
Entry
116748            CDS       T01002                                 
Symbol
Lsm10
Name
(RefSeq) U7 snRNP-specific Sm-like protein LSM10
  KO
K25591  U7 snRNA-associated Sm-like protein LSm10
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    116748 (Lsm10)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    U7-dependent histone pre-mRNA processing factors
     116748 (Lsm10)
SSDB
Motif
Pfam: LSM
Other DBs
NCBI-GeneID: 116748
NCBI-ProteinID: NP_001156738
MGI: 2151045
Ensembl: ENSMUSG00000050188
UniProt: Q8QZX5 Q3UPL7
Position
4:125990355..125992377
AA seq 122 aa
MALSHSVKERTISENSLIILLQGLQGQITTVDLRDESVARGRIDNVDAFMNIRLANVTYT
DRWGHQVELDDLFVTGRNVRYVHIPDGVDITATIEQQLQIIHRVRNFGGKGQGRREFPSK
RP
NT seq 369 nt   +upstreamnt  +downstreamnt
atggcactgagccactcggtgaaggagcgaactatttctgagaacagcctgatcatcctg
ttgcagggcctccaaggccaaataaccactgtggaccttcgggatgagagtgtggcccga
ggacgcattgacaacgtggatgctttcatgaatatccgcctggccaatgtcacctatacc
gaccgctggggacatcaggttgagttggatgacctttttgtgaccggtcgtaacgtccga
tacgtccatatcccagatggtgtggacatcactgctactattgagcagcagctgcagatc
atccaccgtgtgcgcaactttggtggcaagggtcaaggtcgtcgagagttcccctccaaa
aggccatga

DBGET integrated database retrieval system