KEGG   Mus musculus (mouse): 11682
Entry
11682             CDS       T01002                                 

Gene name
Alk, CD246, Tcrz
Definition
(RefSeq) anaplastic lymphoma kinase
  KO
K05119  anaplastic lymphoma kinase [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05200  Pathways in cancer
mmu05223  Non-small cell lung cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    11682 (Alk)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    11682 (Alk)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    11682 (Alk)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    11682 (Alk)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    11682 (Alk)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     11682 (Alk)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  ALK family
   11682 (Alk)
CD molecules [BR:mmu04090]
 Proteins
  11682 (Alk)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase MAM Gly_rich Ldl_recept_a FXa_inhibition
Other DBs
NCBI-GeneID: 11682
NCBI-ProteinID: NP_031465
MGI: 103305
Ensembl: ENSMUSG00000055471
UniProt: P97793
Position
17 E1.3; 17 43.77 cM
AA seq 1621 aa
MGAAGFLWLLPPLLLAAASYSGAATDQRAGSPASGPPLQPREPLSYSRLQRKSLAVDFVV
PSLFRVYARDLLLPQPRSPSEPEAGGLEARGSLALDCEPLLRLLGPLPGISWADGASSPS
PEAGPTLSRVLKGGSVRKLRRAKQLVLELGEETILEGCIGPPEEVAAVGILQFNLSELFS
WWILHGEGRLRIRLMPEKKASEVGREGRLSSAIRASQPRLLFQIFGTGHSSMESPSETPS
PPGTFMWNLTWTMKDSFPFLSHRSRYGLECSFDFPCELEYSPPLHNHGNQSWSWRHVPSE
EASRMNLLDGPEAEHSQEMPRGSFLLLNTSADSKHTILSPWMRSSSDHCTLAVSVHRHLQ
PSGRYVAQLLPHNEAGREILLVPTPGKHGWTVLQGRVGRPANPFRVALEYISSGNRSLSA
VDFFALKNCSEGTSPGSKMALQSSFTCWNGTVLQLGQACDFHQDCAQGEDEGQLCSKLPA
GFYCNFENGFCGWTQSPLSPHMPRWQVRTLRDAHSQGHQGRALLLSTTDILASEGATVTS
ATFPAPMKNSPCELRMSWLIRGVLRGNVSLVLVENKTGKEQSRTVWHVATDEGLSLWQHT
VLSLLDVTDRFWLQIVTWWGPGSRATVGFDNISISLDCYLTISGEEKMSLNSVPKSRNLF
EKNPNKESKSWANISGPTPIFDPTVHWLFTTCGASGPHGPTQAQCNNAYQNSNLSVVVGS
EGPLKGVQIWKVPATDTYSISGYGAAGGKGGKNTMMRSHGVSVLGIFNLEKGDTLYILVG
QQGEDACPRANQLIQKVCVGENNVIEEEIRVNRSVHEWAGGGGGGGGATYVFKMKDGVPV
PLIIAAGGGGRAYGAKTETFHPERLESNSSVLGLNGNSGAAGGGGGWNDNTSLLWAGKSL
LEGAAGGHSCPQAMKKWGWETRGGFGGGGGGCSSGGGGGGYIGGNAASNNDPEMDGEDGV
SFISPLGILYTPALKVMEGHGEVNIKHYLNCSHCEVDECHMDPESHKVICFCDHGTVLAD
DGVSCIVSPTPEPHLPLSLILSVVTSALVAALVLAFSGIMIVYRRKHQELQAMQMELQSP
EYKLSKLRTSTIMTDYNPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVS
GMPNDPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQALPRFILL
ELMAGGDLKSFLRETRPRPNQPTSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCL
LTCPGAGRIAKIGDFGMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFG
VLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNF
AIILERIEYCTQDPDVINTALPIEYGPVVEEEEKVPMRPKDPEGMPPLLVSPQPAKHEEA
SAAPQPAALTAPGPSVKKPPGAGAGAGAGAGAGPVPRGAADRGHVNMAFSQPNPPPELHK
GPGSRNKPTSLWNPTYGSWFTEKPAKKTHPPPGAEPQARAGAAEGGWTGPGAGPRRAEAA
LLLEPSALSATMKEVPLFRLRHFPCGNVNYGYQQQGLPLEATAAPGDTMLKSKNKVTQPG
P
NT seq 4866 nt   +upstreamnt  +downstreamnt
atgggagctgctgggttcctgtggctgctgcctccactgcttttggcagcagcctcgtac
tccggagctgcaaccgatcagcgcgcgggttccccagcctcagggcctcctctgcagccc
cgggagccgctcagttattcgcgcctgcagaggaagagtctggcagtggacttcgttgta
ccctcgctcttccgcgtctatgcccgagacctgctgctaccgcagccacggtccccctcg
gagcccgaggctggcgggctggaggcgcggggatcactggccctggattgtgagcctctg
ctcaggctgctggggccactgcctggaatctcctgggcagatggagccagttctcctagt
cccgaggcgggtccgacgctgtccagggtgctgaagggaggctcggtgcgcaagctcagg
cgtgccaaacagctggtgctggagctgggcgaggagacgattcttgaaggctgtattggt
cccccagaggaggtagcggctgtggggatactccagttcaacctcagcgagctgttcagc
tggtggattctccacggcgaagggaggctgaggatccgcctgatgcctgagaagaaggca
tcggaagtgggcagggagggaaggctatccagtgcgatccgagcctcccagccccgcctt
ctcttccagatcttcgggacgggacacagctccatggagtcaccctcagaaacgccttct
cctcctggtaccttcatgtggaatctgacctggacgatgaaagactccttccctttcctt
tcccaccgcagtcgatatggtctggagtgcagctttgacttcccctgtgagctggaatat
tctcctcccctgcacaaccacgggaatcagagctggtcctggcgccatgtgccctccgag
gaggcctcgaggatgaacttgctggatgggccagaggcagagcattctcaagagatgccc
agaggctccttcctcctcctgaacacctctgcagattccaagcataccattctgagccca
tggatgaggagcagtagtgatcactgcacactggctgtctccgtgcacagacatctacag
ccttcggggagatatgttgcccagctcctaccccacaacgaagctggaagagagattctt
ttggtgcccaccccagggaagcatggctggacagtgctgcaggggagagtcgggcgccca
gcaaacccatttcgagtggctctggaatacatctccagtggcaaccggagcttgtcggcg
gtggatttctttgccctgaagaactgcagtgaagggacatccccaggctccaagatggca
ttgcagagttccttcacttgttggaatgggaccgtcctccagctcgggcaagcctgtgat
ttccaccaggactgtgcccaaggagaagatgagggccagctgtgcagtaaacttcctgct
ggattttactgtaactttgaaaatggcttctgtggctggacccaaagtccactctcaccc
catatgccccggtggcaagtgaggaccctaagagatgcccattcccagggccaccaaggc
cgtgccctgttgctcagcaccactgacatcctcgcttctgaaggtgcaacagtgaccagt
gccaccttccctgcaccaatgaaaaattctccttgtgagctccgcatgtcctggctcatc
cgcggggttttgagaggaaacgtatctctggtgctggtggagaacaaaaccggaaaggag
caaagccggactgtctggcatgtcgccactgacgaaggcttaagcctgtggcagcataca
gtgctgtccctcctcgatgtgactgacaggttctggctgcagatagtcacatggtggggt
ccaggatccagggcaaccgtgggatttgacaacatttccatcagcctcgactgctacctt
accatcagtggagaggagaaaatgtccctgaattcagtacccaaatctagaaatctgttt
gagaaaaacccaaacaaggagtcaaaatcctgggcaaacatatcaggaccaactcccatc
ttcgaccctacagttcactggctgttcaccacgtgtggggccagtggacctcatggcccc
acccaggcacagtgcaacaacgcctaccagaattccaacttgagcgtggtggtgggaagt
gaagggcccttgaagggagtccagatttggaaagtgccagctactgacacctacagtatc
tcgggctacggagcagctggcgggaaaggtgggaaaaacaccatgatgcggtcccatggc
gtgtctgtcctgggcatcttcaatctggagaaaggtgacacactctacatccttgtcggt
cagcaaggggaggatgcctgtcccagggcaaaccaactaatccagaaagtctgtgtgggt
gagaacaatgtcatagaagaagagatccgagtgaacagaagcgtgcacgagtgggcagga
ggaggaggaggtgggggtggagccacctacgtgtttaagatgaaagatggcgtgcctgta
cccctgatcattgcagctggtggtggtggcagggcctatggggccaagacagaaacgttc
cacccagagagactggagagtaactcctcggttctagggctgaacggcaattccggagcc
gcaggtggtggaggcggctggaatgataacacttccttgctctgggccggaaagtctttg
ctggagggtgccgccggaggacattcctgcccccaggccatgaagaagtgggggtgggag
acaagagggggtttcggagggggtggaggggggtgctcctcaggtggaggaggcggagga
tatataggtggcaacgcagcatcaaacaatgaccccgaaatggatggggaagatggggtt
tccttcatcagtccattgggtatcctgtacaccccggccttaaaagtgatggagggccac
ggggaagtgaatatcaagcattatctaaactgcagtcactgcgaggtagacgaatgtcac
atggaccccgagagccacaaagtcatctgcttctgtgatcatgggaccgtgctggctgat
gatggtgtctcctgcattgtgtcacccaccccggagccccacctgccgctctcattgatc
ctctccgtcgtgacctctgccctggtggctgcccttgttctggcattctccggcatcatg
attgtgtaccgtcggaagcaccaggagttgcaggctatgcagatggaactgcagagcccc
gagtataagctgagcaagctacggacctcgaccatcatgaccgactacaaccccaactac
tgcttcgctggcaagacttcctccatcagtgacctgaaagaagtgccacggaaaaacatc
acactcatccggggcctaggccatggcgcatttggggaggtgtatgaaggccaggtgtct
ggaatgcccaatgacccaagccctctacaagtggctgtaaagacgctgccagaagtgtgt
tcagaacaagatgagctggactttctcatggaagctctgatcatcagcaaattcaaccac
cagaatattgttcgctgcatcggggtgagtctacaagccctgccccgcttcatcctgctg
gaactcatggctggcggagacctcaagtccttcctcagggagacacgccctcgcccgaac
caacccacctccctggccatgctggaccttctgcatgtggctcgggacattgcctgtggc
tgtcagtacctagaggagaatcactttatccaccgggatattgctgctagaaactgtctg
ttgacctgcccaggagctggaagaatagcaaagattggagactttgggatggcccgagat
atctacagggccagctactaccgaaagggaggctgcgccatgctgccggtcaagtggatg
ccccctgaagccttcatggaagggatatttacctctaaaacagacacatggtcttttgga
gtgttgctatgggaaatattttctcttggatatatgccgtaccccagcaagagcaaccag
gaagttctggagtttgtcaccagcggaggacggatggacccgcctaagaactgccccggg
cctgtataccggataatgacgcagtgctggcagcatcagcctgaagacagacccaacttc
gccatcattttggagaggatcgaatactgcacccaggaccccgatgtgatcaacacagct
ctgcccatcgaatacggtccagtagtagaagaggaggagaaagtgcccatgcgccccaaa
gaccccgaggggatgccacctttgctggtgtctccccagcctgcgaagcacgaggaggcg
tccgcagctccccagcccgcagccctgacggcaccaggcccatcggtgaagaagcccccg
ggtgcgggtgcgggcgcgggcgcgggtgcgggtgccggcccggtgccccgaggtgcggcc
gatcggggccacgtgaacatggctttctctcagcccaaccctcccccggagctgcacaaa
ggcccgggatccagaaacaagccgaccagcctgtggaaccccacctacggctcgtggttc
accgagaagcctgccaaaaagacccatcctccgccaggcgccgagccgcaggcgcgggca
ggagcggccgagggtggctggaccgggccgggcgcggggccccgcagagccgaggcagcg
ctgctgctagagccatcggcgctgagcgccaccatgaaggaggtgccgctgttcaggctg
cgccacttcccctgcggcaatgtcaactatggttaccagcaacagggtctccccttggaa
gccacagccgcgccaggggacaccatgctgaaaagcaagaataaggtcacccagccgggg
ccctga

DBGET integrated database retrieval system