KEGG   Mus musculus (mouse): 11685
Entry
11685             CDS       T01002                                 

Gene name
Alox12e, 12-LOX, 12-LOX-e, 8-L, 8-LOX, AW259591, Al, Alox1, Alox12-ps1, Alox12-ps2, Aloxe, e-LO, e-LOX1
Definition
(RefSeq) arachidonate lipoxygenase, epidermal
  KO
K00458  arachidonate 12-lipoxygenase [EC:1.13.11.31]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00590  Arachidonic acid metabolism
mmu01100  Metabolic pathways
mmu01523  Antifolate resistance
mmu04726  Serotonergic synapse
mmu04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    11685 (Alox12e)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    11685 (Alox12e)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    11685 (Alox12e)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    11685 (Alox12e)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.31  arachidonate 12-lipoxygenase
     11685 (Alox12e)
SSDB
Motif
Pfam: Lipoxygenase PLAT
Other DBs
NCBI-GeneID: 11685
NCBI-ProteinID: NP_663717
MGI: 1274790
Ensembl: ENSMUSG00000018907
Vega: OTTMUSG00000006041
UniProt: P55249 Q5F2E4
Position
11 B3; 11 42.99 cM
AA seq 662 aa
MVKYKILVATGDSVFAGSANLVHLWLVGEHGEADLGKQLRPLLGRKTELEVDVPLHLGRL
LAVKLRKQKGLLDSDWFCKSITVQGPGTQGEAFFPCYSWVQGKETICLTEGTALKVTDDT
QNLFRKYREQELENRRNVYRWGSWKEGLILPIAGSTERDLPRNQRFMKDKDLDFSLSLVK
ELKNFAIKGTLDFVSRVQKLEDYQKVFPHTKTALPERVRGSWKEDALFGYQFLNGANPML
LRRSMRLPARLVLPPGMEDVQTQLEKELKAGSLFEVDFSLLDGVKPNIIIFKQQYVTAPL
VMLKLQPDGRLLPMVIQLQPPRHGCPPPLLFLPSDPPMAWLLAKIWVRSSDFQLHQLQSH
LLRGHLMAEVISVATMRSLPSLHPIYKLLAPHFRYTMEINTLARNNLVSEWGIFDLVVST
GSGGHVDILQRATSCLTYRSFCPPDDLADRGLVGVKSSLYAQDALRLWEIISRYVERMVE
LFYRSDTDVKEDPELQVWCREVTEVGLLGAQDRGFPLSLESRAELCRFVAMCIFTCTGQH
ASTHLGQLDWYAWIPNGPCTMRKPPPISKDVTERDIVDSLPCLQQARMQITVTKFLGRRQ
PVMVALGQHKEEYFSGPRPRDVLKQFQEELAIMDKEIEVRNASLDLPYEYLRPSLVENSV
TI
NT seq 1989 nt   +upstreamnt  +downstreamnt
atggtcaagtacaagatcctcgtagccactggagactcggtttttgcgggctccgccaac
ctggtgcatctgtggctggtgggcgagcatggagaggcggaccttgggaagcagctgcgg
ccactgctgggaaggaagacagagctggaggtcgacgtccccttgcatctagggcgcctc
ctggcggtgaagctgcgcaaacagaaaggcctattggattctgactggttctgcaagagc
atcactgtgcagggccctgggacccaaggagaagcctttttcccctgctacagttgggtg
cagggcaaggagactatctgcctaaccgagggcactgccctgaaggtaactgatgacact
cagaacctgtttaggaagtatcgagagcaggagctggagaacagaaggaatgtgtatcgg
tggggctcctggaaggagggattaatcctgcctatagcagggagtactgaacgggacctc
ccccggaaccagagattcatgaaggataaggatttagatttttccctctctctggtcaaa
gagttgaagaactttgctattaaggggactctagattttgtaagtcgtgtacaaaagctg
gaagattaccagaaagtattcccacatacaaagactgctctgcctgagcgggtccgtggt
tcctggaaggaagatgctctctttgggtaccagttcctcaacggtgcaaaccccatgctc
ctgaggcggtccatgcgccttccagcccggctggtcctgcctccagggatggaagacgta
cagacccagctggagaaggagctcaaggctggatctctgttcgaagttgatttctccctg
ctggatggagtcaaacctaacatcatcatttttaagcagcaatatgtgacagcccctttg
gtcatgctgaaactacagcccgatgggaggctcttacccatggtcatccagctccagcca
ccacgacacggatgtcccccgcctctgctcttcttgccctcagatccccccatggcctgg
ctcttggccaagatctgggtccgaagctctgacttccaactgcaccagttacagtcacat
ctgctgaggggacacctcatggccgaggttatttctgtggccacaatgaggagtttaccc
agcctgcaccccatatacaagctccttgccccccactttcgatacaccatggagatcaac
accctggcacggaataatcttgtctccgaatggggaatttttgacctggtggtgagcacg
gggagcggaggccatgtggacattctccagagagccacgtcgtgtttgacctaccgctcc
ttttgccctccggatgacttggctgaccgtggactcgtgggggtgaaatcttctctgtat
gcccaggatgccctcaggctgtgggagatcatcagtcggtatgtggaaaggatggttgag
cttttctacaggagtgacaccgatgtgaaggaggacccggagctgcaggtctggtgccgc
gaggtcactgaggttggactgcttggagcccaggaccgagggttccccctgtccttagag
tcccgggctgagctgtgccgctttgtcgctatgtgcatcttcacgtgcactggtcagcac
gcatctacacatctgggtcagctggactggtatgcctggatcccaaatggcccatgcacc
atgcggaagcccccacccatctccaaggatgtgacagagagggacattgtggactcgttg
ccttgccttcagcaggcacggatgcagataacagtcaccaagttccttggcagacgccag
cctgtcatggtggccctggggcagcataaagaggagtatttctcaggccccaggccccgg
gatgtgctgaagcaattccaggaggagctggctatcatggacaaggagattgaggtccgg
aatgcaagcctggacctgccctatgagtacctccgacccagcctggtggaaaacagtgtg
accatctga

DBGET integrated database retrieval system