KEGG   Mus musculus (mouse): 11689Help
Entry
11689             CDS       T01002                                 

Gene name
Alox5, 5-LO, 5-LOX, 5LO, 5LX, AI850497, F730011J02
Definition
(RefSeq) arachidonate 5-lipoxygenase
  KO
K00461  arachidonate 5-lipoxygenase [EC:1.13.11.34]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00590  Arachidonic acid metabolism
mmu01100  Metabolic pathways
mmu04664  Fc epsilon RI signaling pathway
mmu04726  Serotonergic synapse
mmu04913  Ovarian steroidogenesis
mmu05145  Toxoplasmosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    11689 (Alox5)
 09150 Organismal Systems
  09151 Immune system
   04664 Fc epsilon RI signaling pathway
    11689 (Alox5)
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    11689 (Alox5)
  09156 Nervous system
   04726 Serotonergic synapse
    11689 (Alox5)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    11689 (Alox5)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.34  arachidonate 5-lipoxygenase
     11689 (Alox5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipoxygenase PLAT
Motif
Other DBs
NCBI-GeneID: 11689
NCBI-ProteinID: NP_033792
MGI: 87999
Ensembl: ENSMUSG00000025701
Vega: OTTMUSG00000036516
UniProt: P48999
Position
6 E3; 6 53.79 cM
AA seq 674 aa AA seqDB search
MPSYTVTVATGSQWFAGTDDYIYLSLIGSAGCSEKHLLDKAFYNDFERGAVDSYDVTVDE
ELGEIYLVKIEKRKYWLHDDWYLKYITLKTPHGDYIEFPCYRWITGEGEIVLRDGRAKLA
RDDQIHILKQHRRKELEARQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVL
NYSKAMENLFINRFMHMFQSSWHDFADFEKIFVKISNTISERVKNHWQEDLMFGYQFLNG
CNPVLIKRCTALPPKLPVTTEMVECSLERQLSLEQEVQEGNIFIVDYELLDGIDANKTDP
CTHQFLAAPICLLYKNLANKIVPIAIQLNQTPGESNPIFLPTDSKYDWLLAKIWVRSSDF
HVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPLFKLLVAHVRFTIAINTKAREQLICEYG
LFDKANATGGGGHVQMVQRAVQDLTYSSLCFPEAIKARGMDSTEDIPFYFYRDDGLLVWE
AIQSFTMEVVSIYYENDQVVEEDQELQDFVKDVYVYGMRGKKASGFPKSIKSREKLSEYL
TVVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCW
HLGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMIRFRKNLEAIVSVIAERNKNKKLPY
YYLSPDRIPNSVAI
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgccctcctacacggtcaccgtggccaccggcagccagtggttcgcgggcaccgacgac
tacatctacctcagcctcattggctctgcgggctgtagcgagaagcatctgctggacaag
gcattctacaatgacttcgaacggggcgcggtggactcctacgatgtcaccgtggatgag
gagctgggcgagatctacctagtcaaaattgagaagcgcaaatactggctccatgatgac
tggtacctgaagtacatcacactgaagacaccccacggggactacatcgagttcccatgt
taccgctggatcacaggcgagggcgagattgtcctgagggatggacgtgcaaaattggcc
cgagatgaccaaattcacatcctcaagcagcacagacgtaaagaactggaggcacggcaa
aaacagtatcgatggatggagtggaaccccggcttccctttgagtattgatgccaaatgc
cacaaggatctgccccgagatatccagtttgatagtgaaaaaggagtggactttgttctg
aactactcaaaagcgatggagaacctgttcatcaaccgcttcatgcacatgttccagtct
tcctggcacgactttgctgactttgagaaaatcttcgtcaaaatcagcaacactatatct
gagcgagtcaagaaccactggcaggaagacctcatgtttggctaccagttcctgaatggc
tgcaacccagtactcatcaagcgctgcacagcgttgcccccgaagctcccagtgaccaca
gagatggtggagtgcagcctagagcggcagctcagtttagaacaggaagtacaggaaggg
aacattttcatcgttgattacgagctactggatggcatcgatgctaacaaaactgacccc
tgtacacaccagttcctggctgcccccatctgcctgctatataagaacctagccaacaag
attgttcccattgccatccagctcaaccaaacccctggagagagtaacccaatcttcctc
cctacggattcaaagtacgactggcttttggccaaaatctgggtgcgttccagtgacttc
cacgtccatcaaacgatcacccaccttctgcgcacgcatctggtgtctgaggtgtttggt
atcgccatgtaccgccagctgcctgctgtgcatccccttttcaagctgctggtagcccat
gtgaggttcaccattgctatcaacactaaggcccgggaacagcttatctgcgagtatggc
ctttttgacaaggccaatgccaccgggggtggagggcacgtgcagatggtgcagagggct
gtccaggatctgacctattcctccctgtgtttcccggaggccatcaaggcccggggcatg
gacagcacggaagacatccccttctacttctatcgtgatgatggactgctcgtgtgggag
gctatccagtcgttcacaatggaggtggtgagcatctactatgagaacgaccaggtggtg
gaggaggaccaggaactgcaggacttcgtgaaggatgtttacgtgtacggcatgcggggc
aaaaaggcctcaggtttccccaagtccatcaagagcagggagaagctgtccgagtacctg
acggtggtgatcttcacggcctctgcccagcatgcagctgtaaacttcggccagtatgac
tggtgctcctggatccccaacgctcctccaactatgcgggccccaccacccacggccaag
ggtgtggtcaccatcgagcagatcgtggatactctaccagaccgtggccgatcatgttgg
catctaggtgcagtgtgggccttgagccagtttcaagaaaatgagctgtttctaggcatg
tacccagaggagcatttcattgagaagccagtgaaggaagccatgatccgattccgcaag
aacctggaggccatcgtcagcgtgatcgccgagcgcaataagaacaaaaagctcccctac
tactacctgtcaccagacaggattcccaacagcgtagccatctaa

DBGET integrated database retrieval system