KEGG   Mus musculus (mouse): 116891
Entry
116891            CDS       T01002                                 

Gene name
Derl2, CGI-10, CGI-101, Derl, Derlin-2, F, F-, F-lana, Flana
Definition
(RefSeq) Der1-like domain family, member 2
  KO
K13989  Derlin-2/3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    116891 (Derl2)
SSDB
Motif
Pfam: DER1 Oleosin
Other DBs
NCBI-GeneID: 116891
NCBI-ProteinID: NP_291040
MGI: 2151483
Ensembl: ENSMUSG00000018442
Vega: OTTMUSG00000006077
UniProt: Q8BNI4
Position
11 B4; 11 43.21 cM
AA seq 239 aa
MAYQSLRLEYLQIPPVSRAYTTACVLTTAAVQLELITPFQLYFNPELIFKHFQIWRLITN
FLFFGPVGFNFLFNMIFLYRYCRMLEEGSFRGRTADFVFMFLFGGFLMTLFGLFVSLVFL
GQAFTIMLVYVWSRRNPYVRMNFFGLLNFQAPFLPWVLMGFSLLLGNSIIVDLLGIAVGH
IYFFLEDIFPNQPGGIRILKTPSILRTIFDTPDEDPNYNPLPEERPGGFAWGEGQRLGG
NT seq 720 nt   +upstreamnt  +downstreamnt
atggcgtaccagagcctccggctggagtacctgcagatcccgccggtcagccgcgcctat
actaccgcctgcgtcctcaccaccgcggccgtgcagttggaattgatcacaccttttcag
ttatacttcaatcctgaattaatttttaaacattttcaaatctggaggctaatcaccaat
ttcttattttttggtccagttggattcaattttttgtttaacatgatttttctataccgt
tattgtcgaatgctagaagaaggctctttccgaggtcggacagcagactttgtatttatg
ttcctttttggtggatttttaatgactctctttggtttgtttgtgagcttagttttttta
ggccaggcctttacaataatgctggtctacgtgtggagccgaaggaacccgtatgtccgc
atgaacttctttggtcttctaaacttccaggcccccttcctgccctgggtgctcatgggg
ttttccctgttgctggggaactcaattatagtggaccttttgggtattgcagttgggcac
atatattttttcttggaagatatatttcccaatcagcctggtggaataagaattctgaaa
acaccatctattttgaggactatttttgatacgccagatgaggatcccaattacaaccca
ctacctgaagagcggccgggaggcttcgcctggggtgagggccagcgccttggtgggtaa

KEGG   Mus musculus (mouse): 67819
Entry
67819             CDS       T01002                                 

Gene name
Derl1, 1110021N07Rik, AI195141, AW551338, Derl, Derlin-1
Definition
(RefSeq) Der1-like domain family, member 1
  KO
K11519  Derlin-1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu05014  Amyotrophic lateral sclerosis
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    67819 (Derl1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    67819 (Derl1)
   05022 Pathways of neurodegeneration - multiple diseases
    67819 (Derl1)
SSDB
Motif
Pfam: DER1 DUF3341
Other DBs
NCBI-GeneID: 67819
NCBI-ProteinID: NP_077169
MGI: 1915069
Ensembl: ENSMUSG00000022365
UniProt: Q99J56
Position
15; 15 D1
AA seq 251 aa
MSDIGDWFRSIPAITRYWFAATVAVPLIGKLGIISPAYFFLWPEAFLYRFQIWRPFTATF
YFPVGPGTGFLYLVNLYFLYQYSTRLEAGAFDGRPADYLFMLLFNWICIVITGLAMDMQL
LMIPLIMSVLYVWAQLNRDLIVSFWFGTRFKACYLPWVILGFNYIIGGSVINELIGNLVG
HLYFFLMFRYPMDLGGRNFLSTPQFLYRWLPSRRGGVSGFGVPPASMRRAADQNGGGGRH
NWGQGFRLGDQ
NT seq 756 nt   +upstreamnt  +downstreamnt
atgtcggacatcggggactggttcaggagcatcccggccatcacgcgctactggtttgct
gccaccgttgctgtccccttgatcggcaagctcggcatcatcagcccggcctacttcttc
ctctggcccgaagccttcctctatcgcttccagatatggaggccgttcactgccaccttt
tacttccccgtgggcccagggactggatttctgtatttggtcaatttatatttcttatat
cagtattctactcggcttgaagcaggagcttttgacgggaggccagcagactatttattc
atgcttctctttaactggatctgcatcgttattactggcttagcaatggatatgcagctg
ctgatgatccctctgatcatgtcagtgctctacgtctgggcccagctgaacagagacctg
atcgtgtcgttctggttcggaacgcgatttaaggcctgttacttaccttgggttatcctt
ggattcaactatatcattggaggctcggtgatcaatgagctcattggaaaccttgtcggc
catctttatttcttcctgatgttcagatacccaatggacttgggaggaaggaattttctg
tccacacctcagtttttgtaccgctggctacccagtaggagaggaggggtgtcaggattt
ggtgtgccccctgctagcatgaggcgagctgctgatcagaatggcggaggcgggagacac
aactggggccagggcttccgacttggagaccagtga

KEGG   Mus musculus (mouse): 70377
Entry
70377             CDS       T01002                                 

Gene name
Derl3, 1810006I20Rik, 1810063P04Rik, IZ, IZP6, derl, derlin-3
Definition
(RefSeq) Der1-like domain family, member 3
  KO
K13989  Derlin-2/3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    70377 (Derl3)
SSDB
Motif
Pfam: DER1 Oleosin DUF5326
Other DBs
NCBI-GeneID: 70377
NCBI-ProteinID: NP_077760
MGI: 1917627
Ensembl: ENSMUSG00000009092
UniProt: Q9D8K3 Q14C34
Position
10; 10 C1
AA seq 228 aa
MAGQRLAAGFLQVPAVTRAYTAACVLTTAAVQLELLSPFQLYFNPHLVFRKFQVWRLITT
FLFFGPLGFGFFFNMLFVFRYCRMLEEGSFRGRKADFVFMFLFGGVLMTLLGFLGSLFFL
GQALMAMLVYVWSRRSPHVRVNFFGLLNFQAPFLPWALMGFSLLLGNSVVTDLLGILVGH
IYYFLEDVFPNQPGGKRLLLTPSVLKLLLDDPQEDPDYLPLPEEQPEL
NT seq 687 nt   +upstreamnt  +downstreamnt
atggctgggcagaggctggcggcgggcttcctgcaggtgcccgcggtgacacgcgcctac
accgcggcctgcgtcctcaccacggccgcagtgcagctggagctcctcagccccttccag
ctctacttcaacccgcacctggtgttccggaagttccaggtctggaggctcatcaccacc
ttcctcttcttcgggcccctgggattcggcttctttttcaacatgctcttcgtgttccgc
tactgccgcatgctggaggagggttctttccgtggccgcaaggctgacttcgttttcatg
tttctcttcggtggtgttcttatgactctgctgggattcctgggcagcctgtttttcctg
ggacaggccctcatggccatgctggtctatgtatggagccgtcgcagccctcacgtgagg
gtcaacttcttcggcttactcaacttccaggcaccattcctgccctgggccctcatgggc
ttctcgctgctgctgggcaactcggttgtcacagacctgttagggatccttgtgggccac
atctactacttcctagaagacgtctttcccaaccagcccggaggcaagagactgctgctg
acccccagcgtgttgaagctgctactagatgaccctcaggaagaccccgattacctgccc
cttcccgaagagcagccagagctctaa

DBGET integrated database retrieval system