KEGG   Mus musculus (mouse): 11690
Entry
11690             CDS       T01002                                 

Gene name
Alox5ap, F, Flap
Definition
(RefSeq) arachidonate 5-lipoxygenase activating protein
  KO
K20735  arachidonate 5-lipoxygenase-activating protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04664  Fc epsilon RI signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04664 Fc epsilon RI signaling pathway
    11690 (Alox5ap)
SSDB
Motif
Pfam: MAPEG
Other DBs
NCBI-GeneID: 11690
NCBI-ProteinID: NP_033793
MGI: 107505
Ensembl: ENSMUSG00000060063
Vega: OTTMUSG00000028828
UniProt: P30355
Position
5; 5 G3
AA seq 161 aa
MDQEAVGNVVLLALVTLISVVQNAFFAHKVEHESKAHNGRSFQRTGTLAFERVYTANQNC
VDAYPTFLVVLWTAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL
FLFLMSFAGILNHYLIFFFGSDFENYIRTVSTTISPLLLIP
NT seq 486 nt   +upstreamnt  +downstreamnt
atggatcaagaggctgtgggcaacgttgtgctcctggcccttgtcaccctcatcagcgtg
gtccagaatgcgttctttgcccacaaggtggagcatgaaagcaaggcgcataatgggaga
agcttccagaggaccgggactcttgcctttgagcgggtctacactgccaaccagaactgc
gtagatgcgtaccccactttccttgtggtactctggactgcaggactactttgcagccaa
gtccctgccgccttcgccggactgatgtacctgtttgtgaggcaaaaatactttgtcggc
tatctgggagagagaactcagagcacccctggctacatcttcggcaagcggatcatcctg
ttcctgttcctcatgtccttcgccgggatactcaaccattacctcatcttcttcttcgga
agcgactttgagaactacatcagaacggtaagcacgacgatctccccgctgcttctcatc
ccctga

DBGET integrated database retrieval system