KEGG   Mus musculus (mouse): 116939Help
Entry
116939            CDS       T01002                                 

Gene name
Pnpla3, Adpn
Definition
(RefSeq) patatin-like phospholipase domain containing 3
  KO
K13534  patatin-like phospholipase domain-containing protein 3 [EC:3.1.1.3 2.3.1.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00561  Glycerolipid metabolism
mmu01100  Metabolic pathways
Module
mmu_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    116939 (Pnpla3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     116939 (Pnpla3)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     116939 (Pnpla3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Patatin
Motif
Other DBs
NCBI-GeneID: 116939
NCBI-ProteinID: NP_473429
MGI: 2151796
Ensembl: ENSMUSG00000041653
UniProt: Q91WW7 E9QNZ9
Position
15; 15 E2
AA seq 384 aa AA seqDB search
MYDPERRWSLSFAGCGFLGFYHVGATLCLSERAPHLLRDARTFFGCSAGALHAVTFVCSL
PLGRIMEILMDLVRKARSRNIGTLHPFFNINKCIRDGLQESLPDNVHQVISGKVHISLTR
VSDGENVLVSEFHSKDEVVDALVCSCFIPLFSGLIPPSFRGERYVDGGVSDNVPVLDAKT
TITVSPFYGEHDICPKVKSTNFFHVNITNLSLRLCTGNLQLLTRALFPSDVKVMGELCYQ
GYLDAFRFLEENGICNGPQRSLSLSLVAPEACLENGKLVGDKVPVSLCFTDENIWETLSP
ELSTALSEAIKDREGYLSKVCNLLPVRILSYIMLPCSLPVESAIAAVHRLVTWLPDIQDD
IQWLQWATSQVCARMTMCLLPSTR
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgtatgacccagagcgccgctggagcctgtcgtttgcaggctgcggcttcctgggcttc
taccacgtcggggctacgctatgtctgagcgagcgcgccccgcacctcctccgcgatgcg
cgcactttctttggctgctcggccggtgcactgcacgcggtcaccttcgtgtgcagtctc
cctctcggccgtataatggagatcctcatggacctcgtgcggaaagccaggagccgcaac
atcggcaccctccacccgttcttcaacattaacaagtgcatcagagacgggctccaggag
agcctcccagacaatgtccaccaggtcatttctggcaaggttcacatctcactcaccagg
gtgtcggatggggagaacgtgctggtgtctgagttccattccaaagacgaagtcgtggat
gccctggtgtgttcctgcttcattcccctcttctctggcctaatccctccttccttccga
ggcgagcggtacgtggacggaggagtgagcgacaacgtccctgtgctggatgccaaaacc
accatcacggtgtcacctttctacggtgagcatgacatctgccccaaagtcaagtccacc
aacttcttccacgtgaatatcaccaacctcagcctccgcctctgcactgggaacctccaa
cttctgaccagagcgctcttcccgtctgatgtgaaggtgatgggagagctgtgctatcaa
gggtacctggacgccttccggttcctggaggagaatggcatctgtaacgggccacagcgc
agcctgagtctgtccttggtggcgccagaagcctgcttggaaaatggcaaacttgtggga
gacaaggtgccagtcagcctatgctttacagatgagaacatctgggagacactgtccccc
gagctcagcacagctctgagtgaagcgattaaggacagggagggctacctgagcaaagtc
tgcaacctcctgcccgtcaggatcctgtcctacatcatgctgccctgcagtctgcccgtg
gagtcggctatcgctgcagtccacaggctggtgacatggctccctgatatccaggatgat
atccagtggctacaatgggcgacatcccaggtttgtgcccgaatgacgatgtgcctgctc
ccctctaccaggtaa

DBGET integrated database retrieval system