KEGG   Mus musculus (mouse): 11695Help
Entry
11695             CDS       T01002                                 

Gene name
Alx4, lst
Definition
(RefSeq) aristaless-like homeobox 4
  KO
K09451  homeobox protein aristaless-like 4
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    11695 (Alx4)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Prd
    11695 (Alx4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain OAR Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 11695
NCBI-ProteinID: NP_031468
MGI: 108359
Ensembl: ENSMUSG00000040310
Vega: OTTMUSG00000014563
UniProt: O35137
Position
2 E1; 2 51.62 cM
AA seq 399 aa AA seqDB search
MNAETCVSYCESPAAAMDAYYSPVSQSREGSSPFRGFPGGDKFGTTFLSAGAKGQGFGDA
KSRARYGAGQQDLAAPLESSSGARGSFNKFQPQPPTPQPPPAPPAPPAHLYLQRGACKTP
PDGSLKLQEGSGGHNAALQVPCYAKESNLGEPELPPDSEPVGMDNSYLSVKETGAKGPQD
RASAEIPSPLEKTDSESNKGKKRRNRTTFTSYQLEELEKVFQKTHYPDVYAREQLAMRTD
LTEARVQVWFQNRRAKWRKRERFGQMQQVRTHFSTAYELPLLTRAENYAQIQNPSWIGNN
GAASPVPACVVPCDPVPACMSPHAHPPGSGASSVSDFLSVSGAGSHVGQTHMGSLFGAAG
ISPGLNGYEMNGEPDRKTSSIAALRMKAKEHSAAISWAT
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctgagacttgcgtctcttactgcgagtccccggccgctgccatggacgcctac
tacagcccggtgtcgcagagccgggaaggttcgtcgccttttaggggattcccaggaggc
gacaagttcggtacaacttttctgtcggccggggccaaaggacagggattcggggacgcc
aagagccgggcccgctacggcgcggggcagcaggacctggcggcaccgctggagagcagc
tccggggcgcggggatcctttaacaagttccagccgcagccgcccaccccacagccgccg
cccgctccacccgcgccgcctgcgcatctctacttgcagaggggcgcctgcaaaacgccc
ccggacggtagcctcaagctccaggagggcagcggcggccacaacgcggccttgcaggtc
ccctgctacgccaaagagagcaacctgggtgagccagagttgcctcctgactctgaaccc
gtgggcatggacaacagctacctcagtgtgaaggagacaggggccaaggggccccaggac
cgggccagcgctgaaataccaagccccctggaaaagaccgattctgagagtaacaaaggc
aagaagcggcggaaccgaaccaccttcactagctaccagctggaagagctggagaaagtc
ttccagaagacacactaccctgatgtgtatgcacgggagcagctggctatgaggaccgac
ctcaccgaggcccgtgtgcaggtttggttccagaaccggagggccaagtggcgaaagagg
gagcgctttgggcagatgcagcaggtccggacccacttctccacggcctatgagttgccc
ctcctcacccgggctgagaactacgcccagattcagaacccatcctggattggcaacaat
ggggctgcctcgccagtgccagcctgtgtggtcccctgtgacccggtaccagcctgtatg
tcccctcacgctcaccctcctggctccggggccagcagcgtctccgacttcttgagtgtc
tctggagctggcagtcacgtgggccagacacacatgggcagcctgtttggagcagctggc
atcagtccgggcctcaatggctacgagatgaacggcgagccagaccgcaagacctcaagc
atcgctgccttgcgcatgaaggccaaggagcacagtgcagccatctcttgggccacatga

DBGET integrated database retrieval system