KEGG   Mus musculus (mouse): 11702Help
Entry
11702             CDS       T01002                                 

Gene name
Amd1, AdoMetDC, Amd-1, SAMDC, SAMDC_1, adoMetDC1
Definition
(RefSeq) S-adenosylmethionine decarboxylase 1
  KO
K01611  S-adenosylmethionine decarboxylase [EC:4.1.1.50]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00270  Cysteine and methionine metabolism
mmu00330  Arginine and proline metabolism
mmu01100  Metabolic pathways
Module
mmu_M00034  Methionine salvage pathway
mmu_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    11702 (Amd1)
   00330 Arginine and proline metabolism
    11702 (Amd1)
Enzymes [BR:mmu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.50  adenosylmethionine decarboxylase
     11702 (Amd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SAM_decarbox
Motif
Other DBs
NCBI-GeneID: 11702
NCBI-ProteinID: NP_033795
MGI: 88004
Ensembl: ENSMUSG00000075232
Vega: OTTMUSG00000063451
UniProt: P0DMN7
Position
10 B1; 10 21.85 cM
AA seq 334 aa AA seqDB search
MEAAHFFEGTEKLLEVWFSRQQSDASQGSGDLRTIPRSEWDVLLKDVQCSIISVTKTDKQ
EAYVLSESSMFVSKRRFILKTCGTTLLLKALVPLLKLARDYSGFDSIQSFFYSRKNFMKP
SHQGYPHRNFQEEIEFLNAIFPNGAAYCMGRMNSDCWYLYTLDFPESRVISQPDQTLEIL
MSELDPAVMDQFYMKDGVTAKDVTRESGIRDLIPGSVIDATLFNPCGYSMNGMKSDGTYW
TIHITPEPEFSYVSFETNLSQTSYDDLIRKVVEVFKPGKFVTTLFVNQSSKCRTVLSSPQ
KIDGFKRLDCQSAMFNDYNFVFTSFAKKQQQQQS
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgcacattttttcgaagggacggagaaactgctggaggtctggttttccaga
cagcagtccgacgcaagccagggatctggggatcttcgtaccatcccaagatctgaatgg
gatgtccttttgaaggatgtgcagtgctcaatcataagtgtgacaaagactgacaagcag
gaagcttatgtactcagtgagagtagcatgtttgtctccaagagacgtttcattttgaag
acatgtggtaccaccctcttactgaaagcactggttcccctgttgaagcttgctagggat
tacagtgggtttgactcaattcaaagcttcttttattctcgtaagaatttcatgaagcct
tctcaccaagggtacccacaccggaatttccaggaagaaatcgagtttcttaatgcaatt
ttcccaaatggagcagcatattgtatgggacgcatgaattctgactgctggtacttgtat
actttggatttcccagagagccgagtaatcagtcagccagatcaaacactggaaattctg
atgagtgagcttgacccagcagttatggaccagttctacatgaaagatggtgttactgca
aaggatgtcactcgtgagagtggaattcgtgacctgataccaggttctgtcattgatgcc
acactgttcaatccttgtggctactcgatgaatggaatgaaatcggatggaacatattgg
actattcacatcactccagaaccagaattttcttatgttagctttgaaacaaacctaagt
cagacctcctatgacgacctgatcaggaaagttgtggaagtcttcaagccaggaaaattt
gtgaccaccttgtttgttaatcagagttctaaatgtcgcacagtgctttcttcgccccag
aagattgacggctttaaacgtcttgattgccagagtgctatgttcaacgattacaatttt
gtttttaccagttttgctaagaaacagcaacaacagcagagttga

DBGET integrated database retrieval system