KEGG   Mus musculus (mouse): 117150
Entry
117150            CDS       T01002                                 

Gene name
Pip4k2c, Pip5, Pip5k2c
Definition
(RefSeq) phosphatidylinositol-5-phosphate 4-kinase, type II, gamma
  KO
K00920  1-phosphatidylinositol-5-phosphate 4-kinase [EC:2.7.1.149]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00562  Inositol phosphate metabolism
mmu01100  Metabolic pathways
mmu04070  Phosphatidylinositol signaling system
mmu04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    117150 (Pip4k2c)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    117150 (Pip4k2c)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    117150 (Pip4k2c)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.149  1-phosphatidylinositol-5-phosphate 4-kinase
     117150 (Pip4k2c)
SSDB
Motif
Pfam: PIP5K
Other DBs
NCBI-GeneID: 117150
NCBI-ProteinID: NP_473438
MGI: 2152214
Ensembl: ENSMUSG00000025417
UniProt: Q91XU3
Position
10; 10 D3
AA seq 421 aa
MASSSVPPATAPAAAGGPGPGFGFASKTKKKHFVQQKVKVFRAADPLVGVFLWGVAHSIN
ELSQVPPPVMLLPDDFKASSKIKVNNHFFHRENLPSHFKFKEYCPQVFRNLRDRFAIDDH
DYLVSLTRSPPSETEGSDGRFLISYDRTLVIKEVSSEDIADMHSNLSNYHQYIVKCHGNT
LLPQFLGMYRVSVENEDSYMLVMRNMFSHRLPVHRKYDLKGSLVSREASDKEKVKELPTL
KDMDFLNKNQKVYIGEEEKKVFLEKLKRDVEFLVQLKIMDYSLLLGIHDIIRGSEPEEEG
PVREEESEWDGDCNLAGPPALVGSYGTSPEGIGGYIHSHRPLGPGEFESFIDVYAIRSAE
GAPQKEVYFMGLIDILTQYDAKKKAAHAAKTVKHGAGAEISTVHPEQYAKRFLDFIANIF
A
NT seq 1266 nt   +upstreamnt  +downstreamnt
atggcgtcctcctccgtccctcccgccaccgcacccgcggcagctggaggccccggcccg
ggattcggcttcgcctccaaaaccaagaagaagcatttcgtacagcagaaagtgaaggtg
ttccgggccgcggacccgctggtgggcgtgttcctgtggggcgtcgctcactcgatcaat
gagctcagccaggtaccgcccccagtgatgttgctgccagatgactttaaagccagctcc
aagatcaaggtcaacaatcactttttccatagagaaaatcttcccagtcatttcaagttc
aaggagtattgtccccaggtcttcaggaacctgagagatcggtttgccatcgatgatcac
gattacttggtgtcccttactcgaagccccccaagcgaaactgaaggcagtgatggccgt
ttccttatctcctatgaccgcactctggtcatcaaggaagtgtcgagcgaagatattgcg
gatatgcacagcaacctctccaactaccaccagtacatagtgaaatgtcatggcaacacg
cttctgccccagttcctgggcatgtaccgagtcagtgtagaaaatgaagacagctacatg
ctcgtgatgcgcaatatgtttagtcatcgtcttcctgtgcataggaagtatgacctcaag
ggctctctagtgtcccgggaagccagcgataaggaaaaggttaaagaactgccaacacta
aaggatatggactttcttaacaagaaccagaaagtgtatattggtgaagaagaaaagaaa
gtattcctggagaagctgaagcgagatgtggagtttctagtgcagctgaagatcatggac
tacagcctcctgttgggcatccacgacatcatccggggctctgaacccgaggaagagggg
cctgtgagggaggaggagtctgagtgggatggggactgtaacctggctggacctcccgcc
ctggtgggctcctatggtacctcccctgagggtatcggaggctacatccattcccaccgg
ccactgggcccaggagagtttgagtccttcatcgatgtctatgctatccggagtgcggag
ggggccccccagaaggaggtgtatttcatgggcctcattgacattctgacacagtatgat
gccaagaagaaagcagctcatgcagccaagactgtcaagcacggggcgggggcagagatc
tccactgtccatcctgagcagtatgctaagcgattcctggactttattgccaacatcttt
gcctaa

DBGET integrated database retrieval system