KEGG   Mus musculus (mouse): 117171Help
Entry
117171            CDS       T01002                                 

Gene name
1110038F14Rik
Definition
(RefSeq) RIKEN cDNA 1110038F14 gene
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4615 PDE4_UCR
Motif
Other DBs
NCBI-GeneID: 117171
NCBI-ProteinID: NP_001334469
MGI: 2152337
Ensembl: ENSMUSG00000063236
UniProt: Q3U6N9
Position
15; 15 D3
AA seq 222 aa AA seqDB search
MAEPGRPAREAPAASSRKTHRAPRRPRPSRSASGASEPPLRSSVQPACDSAAGTHPVGNT
VAMKQKKKKTPNRVSGTNGSEKPSEKPAPDEAPPSAEAQAEQLARELAWCVEQLELGLKT
QRPTPKQKEQAVGAIRTLRSEKTPLPRKRQLMRSLFGDYRAQMDAEWREALRALKAATHS
AQVQLVSEATRKKSGRVCRPRPAERAKTTPDLTSEEFRFNFF
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggcggagccagggcgtcctgctcgggaggcaccagcagcctcaagtcggaaaactcat
cgcgctccgcgcagaccccggccctctcgctcagcttccggtgcctcggaacctcctctc
cgcagttcagtgcaacctgcatgcgactccgccgccggaacccatcccgtaggcaacaca
gtagcgatgaagcaaaagaaaaagaaaacccccaacagggtctctgggacaaatggaagc
gaaaagccctcggagaaacctgccccggacgaagctcctcctagcgctgaggcccaggcg
gaacagctggcgcgggagctggcctggtgtgtggaacagctggagctgggtctcaagacg
cagagacctaccccgaagcagaaagagcaggctgttggggcaatccgaacgctgcgcagt
gaaaaaacccccttgccccggaagagacagctgatgcgctccttgtttggggactacagg
gctcagatggatgcagagtggcgggaggccctacgggctctaaaggctgccacccattcg
gcccaggtacagctcgtcagtgaggccaccagaaagaagagcggaagggtctgcaggcct
cgtcctgcagaaagagccaaaaccactccggacttgaccagcgaagagtttcggttcaat
ttcttttag

DBGET integrated database retrieval system