KEGG   Mus musculus (mouse): 11722
Entry
11722             CDS       T01002                                 

Gene name
Amy1, Amy-, Amy-1, Amy1a, C030014B17Rik
Definition
(RefSeq) amylase 1, salivary
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00500  Starch and sucrose metabolism
mmu01100  Metabolic pathways
mmu04970  Salivary secretion
mmu04972  Pancreatic secretion
mmu04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    11722 (Amy1)
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    11722 (Amy1)
   04972 Pancreatic secretion
    11722 (Amy1)
   04973 Carbohydrate digestion and absorption
    11722 (Amy1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     11722 (Amy1)
SSDB
Motif
Pfam: Alpha-amylase_C Alpha-amylase LSR
Other DBs
NCBI-GeneID: 11722
NCBI-ProteinID: NP_001103975
MGI: 88019
Ensembl: ENSMUSG00000074264
Vega: OTTMUSG00000022392
UniProt: P00687
Position
3 F3; 3 49.35 cM
AA seq 511 aa
MKFFLLLSLIGFCWAQYDPHTQYGRTAIVHLFEWRWVDIAKECERYLAPNGFAGVQVSPP
NENIVVHSPSRPWWERYQPISYKICSRSGNEDEFRDMVNRCNNVGVRIYVDAVINHMCGV
GAQAGQSSTCGSYFNPNNRDFPGVPYSGFDFNDGKCRTASGGIENYQDAAQVRDCRLSGL
LDLALEKDYVRTKVADYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNTKWFSQG
SRPFIFQEVIDLGGEAVSSNEYFGNGRVTEFKYGAKLGKVMRKWDGEKMSYLKNWGEGWG
LMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYYWP
RNFQNGKDVNDWVGPPNNNGKTKEVSINPDSTCGNDWICEHRWRQIRNMVAFRNVVNGQP
FANWWDNDSNQVAFGRGNKGFIVFNNDDWALSETLQTGLPAGTYCDVISGDKVDGNCTGI
KVYVGNDGKAHFSISNSAEDPFIAIHAESKI
NT seq 1536 nt   +upstreamnt  +downstreamnt
atgaaattcttcctgctgctttccctcattggattctgctgggcccaatatgacccacat
actcaatatggacgaactgctattgtccacctgtttgagtggcgctgggttgatattgct
aaggaatgtgagagatacttagctcctaatggatttgcaggtgtgcaggtctctccaccc
aatgaaaacatcgtagtccacagcccttcaagaccatggtgggaaagatatcaaccaatt
agctacaaaatatgttccaggtctggaaatgaagatgaattcagggacatggtgaacagg
tgcaacaatgttggtgtccgtatttatgtggatgctgtcattaaccacatgtgtggagtg
ggggctcaagctggacaaagcagtacatgtggaagttatttcaacccaaataacagggac
tttcctggagttccctattctggttttgactttaatgatggaaaatgtagaactgcaagt
ggaggtatcgagaactaccaagatgctgctcaggtcagagattgtcgtctgtctggcctt
ctggatcttgcacttgagaaagattatgttcgaaccaaggtggctgactatatgaaccat
ctcattgacattggcgtagcagggttcagacttgatgcttctaagcacatgtggcctgga
gacataaaggcaattttggacaaactgcataatctcaatacaaaatggttctcccaagga
agcagacctttcattttccaagaggtgattgatctgggtggtgaggcagtgtcaagtaat
gagtattttggaaatggccgtgtgacagaattcaaatatggagcaaaattgggcaaagtt
atgcgcaagtgggatggagaaaagatgtcctacttaaagaactggggagaaggttggggt
ttgatgccttctgacagagcccttgtgtttgtggacaaccatgacaatcagcgaggacat
ggtgctgggggagcatccatcttgacattctgggatgctagactctataaaatggctgtt
ggctttatgttggctcatccttatggtttcacacgggtgatgtcaagttactattggcca
agaaatttccagaatggaaaagatgtcaatgactgggttggaccaccaaataacaatgga
aaaaccaaagaagtgagcattaacccagacagcacttgtggcaatgactggatctgtgaa
catcgatggcgtcaaataaggaacatggttgccttcagaaatgtcgtcaatggtcagcct
tttgcaaactggtgggataatgacagcaaccaggtagcttttggcagaggaaacaaagga
ttcattgtctttaacaatgatgactgggctttgtcagaaactttacagactggtcttcct
gctggcacatactgtgatgtcatttctggagataaagtcgatggcaattgcactggaata
aaagtctatgttggcaatgatggcaaagctcacttttctattagtaactctgccgaagac
ccatttattgcaatccatgcagagtcaaaaatataa

DBGET integrated database retrieval system