KEGG   Mus musculus (mouse): 11732Help
Entry
11732             CDS       T01002                                 

Gene name
Ank, Ankh, D15Ertd221e, mKIAA1581
Definition
(RefSeq) progressive ankylosis
  KO
K22734  progressive ankylosis protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    11732 (Ank)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC62: Pyrophosphate transporter
   11732 (Ank)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANKH UCR_Fe-S_N
Motif
Other DBs
NCBI-GeneID: 11732
NCBI-ProteinID: NP_065065
MGI: 3045421
Ensembl: ENSMUSG00000022265
Vega: OTTMUSG00000026300
UniProt: Q9JHZ2 Q3UG85 Q8C438
Position
15 B1; 15 10.23 cM
AA seq 492 aa AA seqDB search
MVKFPALTHYWPLIRFLVPLGITNIAIDFGEQALNRGIAAVKEDAVEMLASYGLAYSLMK
FFTGPMSDFKNVGLVFVNSKRDRAKAVLCMVVAGAIAAVFHTLIAYSDLGYYIINKLHHV
DESVGSKTRRAFLYLAAFPFMDAMAWTHAGILLKHKYSFLVGCASISDVIAQVVFVAILL
HSHLECREPLLIPILSLYMGALVRCTTLCLGYYRNIHDIIPDRSGPELGGDATIRKMLSF
WWPLALILATQRISRPIVNLFVSRDLGGSSAATEAVAILTATYPVGHMPYGWLTEIRAVY
PAFDKNNPSNKLANTSNTVTSAHIKKFTFVCMALSLTLCFVMFWTPNVSEKILIDIIGVD
FAFAELCVIPLRIFSFFPVPVTVRAHLTGWLMTLKKTFVLAPSSVLRIIVLITSLVVLPY
LGVHGATLGVGSLLAGFVGESTMVALAACYVYRKQKKKMENESATEGEDSAMTDMPPTEE
VTDIVEMREENE
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaattcccggcgctcacgcactactggcccctgatccggttcctggtgcccctc
ggcatcaccaacatagccatcgacttcggggagcaggccttgaaccggggcatcgctgca
gtcaaggaggatgcagtagaaatgctggccagctacgggctggcgtattctttgatgaag
ttcttcacggggcccatgagtgacttcaaaaatgtgggcctggtgttcgtgaacagcaag
agagacagggccaaagccgtcctctgcatggtggtggccggtgccatcgctgccgtcttc
cacaccctgatagcctacagtgacttagggtactacatcatcaacaagctgcatcatgtg
gatgagtctgtggggagcaaaacacgaagggccttcctgtatctcgctgccttccctttt
atggatgccatggcgtggactcatgctggcattctcttaaaacacaaatacagtttcctg
gtgggatgtgcctcaatctcagatgtcatagctcaggttgttttcgtagccattttgctt
cacagtcacctggaatgccgagaaccgctgctcatccccatcctgtctctgtacatgggt
gcgcttgtgcgctgcaccacactgtgcctgggctactacaggaacatccacgacatcatc
cccgacaggagcggcccagagctggggggtgatgcaaccataagaaagatgctgagcttc
tggtggcccctggctctgatcctggccacgcagcgaatcagtcggcccattgtcaacctc
ttcgtgtcccgggaccttggtggcagctctgctgctacagaggcagtggccattctgaca
gccacctaccccgtgggtcatatgccatatggctggttgacagaaatccgggctgtctac
cctgcttttgacaagaataaccccagcaataaactggcgaacacaagcaacacggtcacc
tcagcccacatcaagaagttcacctttgtctgcatggcgctgtcgctgacgctctgtttt
gtcatgttctggacccccaacgtctctgagaagattctgatagatatcattggagtggac
tttgcctttgcagaactctgtgtcattcctctgcgtatcttctccttcttcccagtgcca
gtgactgtgagagctcatctcactggatggctgatgacactgaagaaaacctttgtgctg
gcgcccagctccgtgctgcgcatcatcgtcctcatcaccagccttgtggtcctgccgtac
ctgggggtgcacggagccacactaggtgtgggctcccttctagcagggtttgtgggagaa
tctaccatggttgcccttgcagcatgctatgtctatcgaaaacagaaaaagaagatggag
aatgagtcagccaccgagggagaagactcggccatgaccgacatgcctccaacagaggag
gtcacagacatcgtagagatgagagaagaaaatgagtaa

DBGET integrated database retrieval system