KEGG   Mus musculus (house mouse): 11733
Entry
11733             CDS       T01002                                 
Symbol
Ank1, Ank-1, nb, pale
Name
(RefSeq) ankyrin 1, erythroid
  KO
K10380  ankyrin
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    11733 (Ank1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    11733 (Ank1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filament-binding proteins
    11733 (Ank1)
SSDB
Motif
Pfam: Ank_2 Ank Ank_4 Ank_5 Ank_3 UPA_2 ZU5 Death
Other DBs
NCBI-GeneID: 11733
NCBI-ProteinID: NP_001264210
MGI: 88024
Ensembl: ENSMUSG00000031543
UniProt: Q02357 E9QNT8
Position
8:23464852..23640517
AA seq 1862 aa
MGFCKADAATSFLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVEL
LHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHL
EVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARND
DTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLH
IASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKN
GLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKP
NSRALNGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLL
QRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTG
MVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAA
KYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYT
PLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLG
NKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQ
ADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIAKRLGYISVTD
VLKVVTDETSVVLVSDKHRMSYPETVDEILDVSEDEGDELVGSKAERRDSRDVGEEKELL
DFVPKLDQVVESPAIPRIPCVTPETVVIRSEDQEQASKEYDEDSLIPSSPATETSDNISP
VASPVHTGFLVSFMVDARGGSMRGSRHNGLRVVIPPRTCAAPTRITCRLVKPQKLNTPPP
LAEEEGLASRIIALGPTGAQFLSPVIVEIPHFASHGRGDRELVVLRSENGSVWKEHKSRY
GESYLDQILNGMDEELGSLEELEKKRVCRIITTDFPLYFVIMSRLCQDYDTIGPEGGSLR
SKLVPLVQATFPENAVTKKVKLALQAQPVPDELVTKLLGNQATFSPIVTVEPRRRKFHRP
IGLRIPLPPSWTDNPRDSGEGDTTSLRLLCSVIGGTDQAQWEDITGTTKLIYANECANFT
TNVSARFWLSDCPRTAEAVHFATLLYKELTAVPYMAKFVIFAKMNDAREGRLRCYCMTDD
KVDKTLEQHENFVEVARSRDIEVLEGMPLFAELSGNLVPVKKAAQQRSFHFQSFRENRLA
IPVKVRDSSREPGGFLSFLRKTMKYEDTQHILCHLNITMPPCTKGSGAEDRRRTLTPLTL
RYSILSESRLGFTSDTDRVEMRMAVIREHLGLSWAELARELQFSVEDINRIRVENPNSLL
DQSTALLTLWVDREGENAKMENLYTALRNIDRSEIVNMLEGSGRQSRNLKPERRHGDREY
SLSPSQVNGYSSLQDELLSPASLQYALPSPLCADQYWNEVAVIDAIPLAATEHDTMLEMS
DMQVWSAGLTPSLVTAEDSSLECSKAEDSDAIPEWKLEGAHSEDTQGPELGSQDLVEDDT
VDSDATNGLADLLGQEEGQRSEKKRQEVSGTEQDTETEVSLVSGQQRVHARITDSPSVRQ
VLDRSQARTLDWDKQGSTAVHPQEATQSSWQEEVTQGPHSFQRRITTIQGPEPGALQEYE
QVLVSTREHVQRGPPETGSPKAGKEPSLWAPESAFSQEVQGDELQNIPGEQVTEEQFTDE
QGNIVTKKIIRKVVRQVDSSGAIDTQQHEEVELRGSGLQPDLIEGRKGAQIVKRASLKRG
KQ
NT seq 5589 nt   +upstreamnt  +downstreamnt
atgggcttctgtaaagccgatgctgctaccagctttctgcgggcggcacgctcggggaac
ctggacaaggctctggatcacctgcgcaatggagtggacattaacacctgtaaccagaac
gggttgaacggcctgcatctggcctccaaagaaggccatgtgaagatggtggttgaactt
ctgcacaaagagatcattctagaaacgacaaccaagaaggggaacactgctctgcacatc
gctgcccttgctggtcaggatgaggtggtccgggagctggtcaactatggagccaatgtc
aatgcccagtctcagaaaggctttactcccctgtacatggctgctcaggagaaccacttg
gaagtggtgaaatttctactggagaatggagccaatcagaatgtagccacagaagatggc
ttcaccccactggccgtggctctacagcagggtcacgagaatgtggtggctcacctcatc
aactatgggacgaaagggaaagtgcgcctccctgccctgcacatcgcggcccgcaacgat
gacacacggacagccgcagtccttctgcagaatgaccccaacccagatgtgctttccaag
acgggattcacacccctccacatcgcagctcactatgagaacctcaacgtggcccagttg
ctcctcaacaggggagccagcgtcaacttcacacctcagaatggcatcaccccactacac
atcgcctcccgcagggggaacgtgatcatggtgagactcctgctggaccgaggggctcag
atagaaacgaggaccaaggatgaattgacaccgctccactgtgcagctcggaatggacac
gtgagaatctcagagatcctgctggaccacggggcacccatccaagccaaaaccaagaat
ggcttgtccccaatccacatggccgctcagggagaccacctcgactgtgtccgacttcta
ttgcaatacaatgcagagatagacgacatcaccttggatcacctgactcctctccatgtg
gcagcccactgtggccaccaccgggtggctaaggttcttttggataaaggggccaagccc
aactccagagccctgaatggttttaccccgttacacatcgcctgcaagaagaaccacatc
cgtgtaatggagttgctgctgaagacaggagcctccatcgacgcggtcactgagtctggc
ctgacacctctccacgtagcctccttcatgggacaccttcctattgtgaagaacttactg
cagcggggagcgtcacccaatgtctccaatgtgaaagtagaaacccccttgcacatggca
gcccgagcagggcatacagaagtggccaaatatttgctccagaacaaagccaaagccaac
gccaaggccaaggatgaccagacaccgcttcactgtgctgctcgaatcggccacacaggc
atggtgaagctcctgctggagaatggtgccagccccaatctggctaccactgctggccac
acacccctacacaccgcagcccgtgagggacacgtggacacagccctggccctgctggag
aaggaggcatcccaagcctgcatgaccaagaaaggatttacccctctgcacgtggctgct
aagtacgggaaggtacggttggcggagctgctgctggaacacgatgcacaccccaatgca
gctgggaagaacggcttgactcctctgcatgtggccgtccatcacaacaacctggacatt
gtcaaacttcttcttccccgaggtggctccccccacagccctgcctggaatggctacact
cctttgcacatcgctgccaagcagaaccagatagaggtggcccgcagtctactgcagtac
ggagggtcagcgaatgcagagtcggtacaaggcgtgaccccacttcacctggctgcccaa
gagggccacacagaaatggttgctcttctcctgtccaagcaagccaacggcaacctgggg
aacaagagtggactcactcccctccacctggtgtcacaagaaggccatgttccagtggca
gacgtgctgatcaaacatggcgtcaccgtggatgctaccacccggatgggttacaccccg
ctccatgtggccagtcattatggaaacatcaagctggtgaagttcttgctacagcaccag
gcagatgtcaatgccaagaccaagctaggatacagccccttgcaccaggcagctcaacaa
ggacacacagacattgtgacattgctcctgaagaatggtgcttctccaaatgaggtcagc
tcgaacggaaccacacctctggcaatagccaaacgtttgggctacatctctgtaacagac
gtgctcaaggtggtcacagatgaaaccagtgtggtgttagtcagtgacaaacaccggatg
agctaccctgagacggtggacgagatcctggacgtgtctgaagatgaaggtgacgaactt
gtcggctcgaaggctgaaaggcgggactcccgggatgtgggtgaggagaaagagctgttg
gattttgtgccgaagctagaccaagtggtggagtctccagccatcccaaggatcccttgt
gtcacacctgagaccgttgtgatccgatctgaagatcaggaacaagcatctaaagaatat
gatgaggattccctcattcccagcagcccggccacagagacctcagacaacattagccct
gtggctagcccggtccacacagggttcctggtgagcttcatggtggatgcccgaggggga
tccatgagaggaagccgtcataatggcctcagggtggtgatccctccccggacatgcgca
gcacccactcgcatcacctgccgcctcgttaagccgcagaagctgaacacgccaccccca
ctggctgaggaagagggcctagccagcaggatcattgccctgggacccacgggggcccag
ttccttagccctgtgatcgtggaaatcccccattttgcctcccatggccgtggggaccgt
gagctggtggttctgaggagtgaaaacggctctgtgtggaaggagcacaagagtcgttat
ggggaaagctacctggaccagatccttaatggcatggatgaagagctggggagcctggag
gagctggagaagaaacgtgtgtgccgcatcatcaccaccgacttccctctgtactttgtc
atcatgtcccggctctgccaggactacgacaccatcggtcctgaagggggttccctgaga
agcaagctggtaccgctggtacaggcaacgttccctgaaaacgctgtgaccaagaaagtg
aagctggctctgcaggcccagcctgtcccggatgagctggtgaccaagctcctgggtaac
caggccacattcagccccattgtgaccgtggagccgaggcgtcggaagttccaccgtccc
atcgggctgcgaatcccgctccctccctcatggacggacaaccccagggacagtggggag
ggagacaccaccagcctgcgcctactgtgtagcgtcatcggtggaactgaccaagcccag
tgggaagatataacgggaacaaccaaacttatatacgccaatgagtgtgccaactttacc
accaatgtctcagccaggttctggctgtcagactgtccccggactgcggaggctgtgcac
tttgccactctcctgtacaaagagctcacagcagtcccctacatggctaagtttgtcatt
tttgccaagatgaacgacgctcgggaaggacggctccgttgctactgcatgacggatgac
aaagtggacaagaccctggagcagcatgaaaacttcgtggaggtggcccggagcagggac
atagaggttctggaagggatgcctctgtttgcagaactctctgggaacttggttcctgtc
aagaaagcggcccaacagcggagcttccatttccagtcgtttcgagagaatcgtctggcc
atccccgtgaaggtgagggacagcagccgcgagccaggagggttcttgtcgttcctacga
aagacaatgaagtacgaggacacacagcacatcctctgtcacctgaatatcaccatgccc
ccctgcaccaagggcagtggagcagaagacaggagaaggaccctgacacccctgaccctt
cgatacagcattctcagcgagtcgcggctgggttttaccagtgacacagaccgtgtcgaa
atgaggatggctgtcatcagagaacacctcggcctaagctgggcagagctggcccgggag
ctgcagttcagcgtggaagacatcaaccggatccgtgtagaaaaccctaactccttgttg
gaccagagtacagccttgctgaccctctgggtggaccgtgaaggcgaaaatgcaaagatg
gagaatttgtacacagccctgcggaacatcgacaggagtgagattgttaacatgttggag
ggctccggcaggcagagcagaaacctcaaaccagagcggagacatggggaccgggagtac
tcattgtcaccctcccaggtgaatggttactcctcgctgcaggacgagctgctgtccccc
gcctccctgcagtacgctctcccctctccactgtgtgcagaccagtactggaacgaagtg
gccgtcatagacgccatccccctggcggctacagagcatgacaccatgctggagatgtct
gacatgcaggtgtggtctgcgggcctcacaccctccctggtcactgctgaggactcctct
ctggagtgcagcaaggctgaggactctgacgccataccagagtggaagttggaaggggca
cactcagaggacacgcagggcccggagctgggctctcaggacctggtggaggacgacaca
gtggattcagatgccacaaatggcctggcagatttgctaggtcaggaggaaggtcagagg
tcagaaaagaagaggcaggaagtctcaggcacagagcaggacacggagactgaagtgtct
cttgtttcaggccagcagcgagttcacgcccgaatcacagactcaccctcagtgaggcag
gtgctggacagaagccaggccagaacactggactgggataaacagggttccacagcggta
cacccgcaagaagccacacagagctcctggcaagaggaggtcacgcagggcccacactca
ttccagagaaggatcaccaccatccaagggccggagcctggtgcgcttcaggaatacgag
caggtgctggtgtctaccagggagcatgtgcagagggggccacctgagaccggcagcccc
aaagctggcaaggaacctagcctgtgggcacctgagagcgccttctctcaagaggtgcag
ggggatgagcttcagaatattccaggagagcaggtgacggaggaacaattcacagatgaa
cagggcaacattgttaccaagaagatcattcgcaaagtcgtccggcaggtagactcgtct
ggtgccatcgacacccagcagcacgaggaggtggagctaagagggagtggactccagccg
gacctgatagagggcaggaagggggctcagatagtgaagcgggccagcctgaaaaggggc
aagcagtga

DBGET integrated database retrieval system