KEGG   Mus musculus (mouse): 11746Help
Entry
11746             CDS       T01002                                 

Gene name
Anxa4, AI265406, AIV, AW106930, Anx4, Xanx-4
Definition
(RefSeq) annexin A4
  KO
K17093  annexin A4
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    11746 (Anxa4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    11746 (Anxa4)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    11746 (Anxa4)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    11746 (Anxa4)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   11746 (Anxa4)
  Exosomal proteins of other body fluids (saliva and urine)
   11746 (Anxa4)
  Exosomal proteins of colorectal cancer cells
   11746 (Anxa4)
  Exosomal proteins of bladder cancer cells
   11746 (Anxa4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Annexin TSLP
Motif
Other DBs
NCBI-GeneID: 11746
NCBI-ProteinID: NP_001318049
MGI: 88030
Ensembl: ENSMUSG00000029994
Vega: OTTMUSG00000022166
UniProt: P97429
Position
6 D1; 6 37.75 cM
AA seq 319 aa AA seqDB search
MEAKGGTVKAASGFNATEDAQTLRKAMKGLGTDEDAIIGILAYRNTAQRQEIRSAYKSTI
GRDLIEDLKSELSSNFEQVILGLMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEE
IRRINQTYQQQYGRSLEEDICSDTSFMFQRVLVSLSAAGRDEGNYLDDALMKQDAQELYE
AGEKRWGTDEVKFLSILCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIV
KCMRSKPSYFAERLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRASFKRLYGKSLYSFIK
GDTSGDYRKVLLVLCGGDD
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggaagccaaaggaggaaccgtgaaagctgcttcaggattcaacgcaactgaagatgcc
cagaccctgaggaaggccatgaaaggcctcggtactgatgaagatgccattatcggaatc
ttagcctacagaaacaccgcccagcgccaggagatcaggagtgcctacaagagcaccatt
ggcagggacctgattgaggacttgaagtcggagctgagcagcaactttgagcaggtgatc
ctggggctgatgacacccacagtgctgtatgacgtacaggagctgcggagggccatgaag
ggagctggcacggacgagggctgtctgattgagatcctggcctctcgtacccctgaggag
atccgtcgaatcaaccagacataccagcagcaatatggaaggagccttgaagaggacatc
tgctctgacacatccttcatgttccagcgagtactggtgtccctgtcggcggctggcagg
gatgaaggaaattaccttgatgatgctcttatgaagcaggacgcccaggaactgtatgag
gctggagagaagagatgggggacagacgaggtgaaattcctaagcattctctgttcccgg
aaccggaaccatctgctccacgtgtttgatgaatacaaaagaatctcacagaaggacatt
gaacagagcattaagtctgagacatctggaagctttgaagatgccctgttggctatagtg
aagtgcatgcggagtaaaccttcatatttcgctgagagactttataaatccatgaagggc
ttaggcactgatgacaacaccctcatcagagtgatggtctcaagagcagagattgacatg
ctggacatccgggcgagcttcaagaggctctacgggaagtctttgtactctttcatcaag
ggtgacacttccggagactacaggaaggttctgctcgttctctgtggaggagatgattaa

DBGET integrated database retrieval system