KEGG   Mus musculus (mouse): 11747
Entry
11747             CDS       T01002                                 

Gene name
Anxa5, An, Anx5, R74653
Definition
(RefSeq) annexin A5
  KO
K16646  annexin A5
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    11747 (Anxa5)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    11747 (Anxa5)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   11747 (Anxa5)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Others
   11747 (Anxa5)
SSDB
Motif
Pfam: Annexin DUF2312
Other DBs
NCBI-GeneID: 11747
NCBI-ProteinID: NP_033803
MGI: 106008
Ensembl: ENSMUSG00000027712
Vega: OTTMUSG00000020273
UniProt: P48036
Position
3 B; 3 17.46 cM
AA seq 319 aa
MATRGTVTDFPGFDGRADAEVLRKAMKGLGTDEDSILNLLTSRSNAQRQEIAQEFKTLFG
RDLVDDLKSELTGKFEKLIVAMMKPSRLYDAYELKHALKGAGTDEKVLTEIIASRTPEEL
SAIKQVYEEEYGSNLEDDVVGDTSGYYQRMLVVLLQANRDPDTAIDDAQVELDAQALFQA
GELKWGTDEEKFITIFGTRSVSHLRRVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVK
SIRSIPAYLAETLYYAMKGAGTDDHTLIRVVVSRSEIDLFNIRKEFRKNFATSLYSMIKG
DTSGDYKKALLLLCGGEDD
NT seq 960 nt   +upstreamnt  +downstreamnt
atggctacgagaggcactgtgactgacttccctggatttgatggcagggctgatgcagaa
gtccttcggaaggccatgaaaggcttgggtaccgatgaggacagcatcctgaacctgttg
acatcccgaagcaatgctcagcgccaggaaattgctcaggagtttaagactctgtttggc
agggaccttgtggatgacctgaagtctgaactgactggaaagtttgagaagttaattgtg
gctatgatgaagccctcacgactctacgatgcctacgagctgaagcatgctcttaaggga
gctggtacagacgagaaagtattgaccgagattattgcttcaaggacacctgaagaactc
agtgccataaaacaagtttatgaagaagaatatggttccaacctggaagatgatgtggtg
ggggatacttcagggtactaccagaggatgttggtggtcctccttcaggcgaatagagac
cctgatactgcaattgatgatgctcaagttgaactggatgctcaggcattgttccaggct
ggagagctgaagtgggggacagatgaagaaaaattcatcaccatctttgggacacgcagt
gtgtctcatttaagaagagtgtttgacaagtacatgaccatatcaggatttcagattgag
gaaaccattgatcgagagacctcggggaacttggagcagctgctcctggctgtcgtgaag
tctattcggagcatacctgcctaccttgcagagaccctctactatgccatgaagggtgct
gggacggacgatcacaccctcatcagagtcgtggtgtcgaggagtgagattgacctgttt
aacataaggaaggagtttaggaagaacttcgccacctccctgtattctatgatcaagggc
gacacatctggagactataagaaggccctgctgctgctctgcgggggcgaggatgactga

DBGET integrated database retrieval system