KEGG   Mus musculus (mouse): 11749
Entry
11749             CDS       T01002                                 

Gene name
Anxa6, A, AW107198, An, Anx6, AnxVI, Cab, Cabm, Cam, Camb
Definition
(RefSeq) annexin A6
  KO
K17094  annexin A6
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    11749 (Anxa6)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    11749 (Anxa6)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    11749 (Anxa6)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   11749 (Anxa6)
SSDB
Motif
Pfam: Annexin
Other DBs
NCBI-GeneID: 11749
NCBI-ProteinID: NP_038500
MGI: 88255
Ensembl: ENSMUSG00000018340
Vega: OTTMUSG00000006325
UniProt: P14824 Q3UI56
Position
11 B1.3; 11 32.13 cM
AA seq 673 aa
MAKIAQGAMYRGSVHDFPEFDANQDAEALYTAMKGFGSDKESILELITSRSNKQRQEICQ
NYKSLYGKDLIEDLKYELTGKFERLIVNLMRPLAYCDAKEIKDAISGVGTDEKCLIEILA
SRTNEQMHQLVAAYKDAYERDLESDIIGDTSGHFQKMLVVLLQGTRENDDVVSEDLVQQD
VQDLYEAGELKWGTDEAQFIYILGNRSKQHLRLVFDEYLKTTGKPIEASIRGELSGDFEK
LMLAVVKCIRSTPEYFAERLFKAMKGLGTRDNTLIRIMVSRSELDMLDIREIFRTKYEKS
LYSMIKNDTSGEYKKALLKLCGGDDDAAGQFFPEAAQVAYQMWELSAVSRVELKGTVCAA
NDFNPDADAKALRKAMKGIGTDEATIIDIVTHRSNAQRQQIRQTFKSHFGRDLMADLKSE
ISGDLARLILGLMMPPAHYDAKQLKKAMEGAGTDEKTLIEILATRTNAEIRAINEAYKED
YHKSLEDALSSDTSGHFRRILISLATGNREEGGENRDQAQEDAQVAAEILEIADTPSGDK
TSLETRFMTVLCTRSYPHLRRVFQEFIKKTNYDIEHVIKKEMSGDVKDAFVAIVQSVKNK
PLFFADKLYKSMKGAGTDEKTLTRVMVSRSEIDLLNIRREFIEKYDKSLHQAIEGDTSGD
FMKALLALCGGED
NT seq 2022 nt   +upstreamnt  +downstreamnt
atggccaaaatagcacagggtgccatgtaccgaggctctgtccacgacttcccagagttt
gacgcaaatcaggatgctgaggccttgtacacagccatgaagggcttcggcagtgacaag
gagtccatactggagctgatcacctcccgcagcaacaagcagaggcaggagatctgccag
aattacaagtccctgtatggcaaggacctcatcgaagacttgaagtatgagttgacgggg
aagttcgagcggctgatagtgaacctgatgaggccacttgcctattgtgacgccaaagag
attaaagacgccatctcgggcgttggcacagatgagaagtgccttattgaaattttggct
tcccggaccaatgagcagatgcaccagctggtggccgcatacaaagacgcctatgagcga
gacctggaatctgacatcattggagacacttccggccacttccagaagatgctggtggta
ctgctccagggaacccgggagaatgacgatgttgtgagcgaggatttggtccagcaggat
gtccaggacctgtatgaggcaggggaactgaaatggggaacagatgaggcccagttcatc
tacatcttgggaaaccgcagcaaacagcacctacgactggtgtttgatgagtatctgaag
accacagggaagcccatcgaagccagtatcagaggggagctgtctggagactttgagaag
ctgatgttggccgtggtgaagtgcatccgaagcaccccggagtattttgcggaaaggctg
ttcaaagccatgaagggcctagggacccgagacaacactctgatccgcatcatggtctcc
aggagcgagctggatatgcttgacatccgggagatcttccggaccaagtatgagaagtca
ctctacagcatgatcaagaatgatacttccggtgaatacaagaaggctctgctgaagctg
tgtggaggagatgatgatgccgctggccagttcttcccggaggcagcacaggtggcctat
cagatgtgggaacttagtgcagtgtcccgagtcgagctgaagggtactgtgtgtgcagcc
aatgatttcaaccctgacgctgatgccaaggccctgcggaaagccatgaagggaattgga
actgatgaagccaccatcatcgacatcgtcacccaccggagcaacgcccagcggcagcag
atccggcagaccttcaaatctcactttggccgggatttaatggctgacctgaagtcagag
atctcgggagacctggcaaggctgattctggggctcatgatgccacctgcccattacgat
gctaagcagctgaagaaagctatggagggagccggcacagatgaaaagactctcatagaa
atcctggccacccggaccaatgctgaaatccgggccatcaacgaggcctacaaggaggat
tatcacaagtccctggaggatgccttgagctcagacacatctggccacttcagaaggatt
ctcatttctctggccacaggaaatcgagaggaaggaggagaaaaccgggaccaggcccag
gaagatgcccaggtggctgctgagatcttggaaatagcagacacccccagcggagacaaa
acttccttggagacacgcttcatgaccgtcctgtgcacccgtagctatccccacctgcgc
agagtcttccaggagttcatcaagaagaccaactatgacatagagcatgtcatcaagaag
gagatgtctggggatgtcaaggacgcatttgtggccatcgttcagagtgtcaagaacaag
cctctcttctttgctgataaactgtacaagtccatgaagggtgctggcacagatgagaag
accctcaccagggtgatggtgtctcggagtgagatagatctgctcaacatccggagggaa
ttcattgagaaatatgacaagtctctacaccaagccattgagggtgacacctctggagac
ttcatgaaggctttgcttgctctgtgtggcggagaggactaa

DBGET integrated database retrieval system