KEGG   Mus musculus (mouse): 11757
Entry
11757             CDS       T01002                                 

Gene name
Prdx3, AW822249, Aop1, D0Tohi1, Ef2l, Mer5, Prx3, SP22, TDXM
Definition
(RefSeq) peroxiredoxin 3
  KO
K20011  peroxiredoxin 3 [EC:1.11.1.24 1.11.1.25]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    11757 (Prdx3)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.24  thioredoxin-dependent peroxiredoxin
     11757 (Prdx3)
    1.11.1.25  glutaredoxin-dependent peroxiredoxin
     11757 (Prdx3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   11757 (Prdx3)
SSDB
Motif
Pfam: AhpC-TSA Redoxin 1-cysPrx_C SCO1-SenC Thioredoxin_8
Other DBs
NCBI-GeneID: 11757
NCBI-ProteinID: NP_031478
MGI: 88034
Ensembl: ENSMUSG00000024997
Vega: OTTMUSG00000021212
UniProt: P20108
Position
19 D3; 19 56.52 cM
AA seq 257 aa
MAAAAGRLLWSSVARHASAISRSISASTVLRPVASRRTCLTDILWSASAQGKSAFSTSSS
FHTPAVTQHAPYFKGTAVVNGEFKELSLDDFKGKYLVLFFYPLDFTFVCPTEIVAFSDKA
NEFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNITLLSDITKQISRDYGVLLESA
GIALRGLFIIDPNGVVKHLSVNDLPVGRSVEETLRLVKAFQFVETHGEVCPANWTPESPT
IKPSPTASKEYFEKVHQ
NT seq 774 nt   +upstreamnt  +downstreamnt
atggcggcagctgcgggaaggttgctctggtcctcggttgctcgtcatgcaagtgctatt
tcccggagtatttctgcctcaacagttcttaggcctgttgcttctagaagaacctgtttg
acagacatactgtggtctgcctctgcccaaggaaagtcagcctttagcaccagttcctct
ttccacacccctgctgtcacccagcacgcgccctattttaaaggtactgctgttgtcaat
ggagagttcaaagagctgagtctcgacgactttaagggaaaatacttggtgcttttcttc
taccctttggatttcacatttgtgtgtcctacagaaattgttgctttcagtgacaaagcc
aatgaatttcatgatgtaaactgtgaagtagttgcagtttcagtggattcccacttcagt
catcttgcctggatcaacacaccaagaaagaatggtggtttgggccacatgaacatcaca
ctgttgtcggatataactaagcagatatcccgagactacggagtgctgttggaaagtgct
ggcattgcactcagaggtctcttcattattgaccctaatggtgtcgtcaagcacctgagt
gtcaacgaccttccggtgggccgcagtgtggaagaaacactccgtttggtaaaggcgttc
cagtttgtggagacccatggagaagtctgcccagccaactggacaccagagtcccctacg
atcaagccaagtccaacagcttccaaagagtactttgagaaggtccatcagtag

DBGET integrated database retrieval system