KEGG   Mus musculus (mouse): 117592
Entry
117592            CDS       T01002                                 

Symbol
B3galt6, BB129894, GalTII
Name
(RefSeq) UDP-Gal:betaGal beta 1,3-galactosyltransferase, polypeptide 6
  KO
K00734  galactosylxylosylprotein 3-beta-galactosyltransferase [EC:2.4.1.134]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00532  Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
mmu00534  Glycosaminoglycan biosynthesis - heparan sulfate / heparin
mmu01100  Metabolic pathways
Module
mmu_M00057  Glycosaminoglycan biosynthesis, linkage tetrasaccharide
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00532 Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
    117592 (B3galt6)
   00534 Glycosaminoglycan biosynthesis - heparan sulfate / heparin
    117592 (B3galt6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    117592 (B3galt6)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.134  galactosylxylosylprotein 3-beta-galactosyltransferase
     117592 (B3galt6)
Glycosyltransferases [BR:mmu01003]
 Glycan extension
  O-Glycan
   117592 (B3galt6)
SSDB
Motif
Pfam: Galactosyl_T
Other DBs
NCBI-GeneID: 117592
NCBI-ProteinID: NP_536693
MGI: 2152819
Ensembl: ENSMUSG00000050796
Vega: OTTMUSG00000010988
UniProt: Q91Z92
Position
4; 4 E2
AA seq 325 aa
MKVFRRAWRHRVALGLGGLAFCGTTLLYLARCASEGETPSASGAARPRAKAFLAVLVASA
PRAVERRTAVRSTWLAPERRGGPEDVWARFAVGTGGLGSEERRALELEQAQHGDLLLLPA
LRDAYENLTAKVLAMLTWLDERVDFEFVLKADDDSFARLDAILVDLRAREPARRRRLYWG
FFSGRGRVKPGGRWREAAWQLCDYYLPYALGGGYVLSADLVHYLRLSREYLRAWHSEDVS
LGTWLAPVDVQREHDPRFDTEYKSRGCNNQYLVTHKQSPEDMLEKQQMLLHEGRLCKHEV
QLRLSYVYDWSAPPSQCCQRKEGVP
NT seq 978 nt   +upstreamnt  +downstreamnt
atgaaggtattccggcgcgcttggcggcaccgggtggcgctgggcctaggcggcctggcg
ttctgcggcaccactctgttgtacctggcgcgctgcgcttccgagggcgagacgccctcc
gcttccggagccgctcggccccgcgctaaggccttcctggcggtgctggtggccagtgcg
ccccgcgcggtcgagcgccgcaccgcagtgcgcagcacgtggctggcaccggagaggcgt
ggcggacccgaggacgtgtgggcgcgcttcgccgtgggcactggcggcttaggctcggag
gagcggcgcgctcttgagctcgagcaggcgcagcacggggacctgctgctgctgcccgcc
ctgcgcgacgcctacgagaacctcacggccaaggtcctggccatgctgacctggctggat
gagcgcgtggacttcgagttcgtgctcaaggcggacgacgactcctttgcgcgcctggac
gctatcctggtggacctacgcgcacgggagcccgcacgccgccggcgcctctactggggc
ttcttttccgggcgcgggcgcgtcaagccgggaggtcgctggcgagaagcagcctggcaa
ctctgcgactactacctgccctacgcgttgggcggtggctatgtcctttctgcggacctg
gtgcattacctgcgcctcagccgcgagtacctgcgcgcgtggcacagtgaagacgtatcg
ctgggcacctggctggcaccagtggatgtgcaacgggagcacgacccacgcttcgacacg
gagtacaaatctcgaggctgcaacaatcagtatctggtgacacacaagcaaagcccagag
gacatgttggagaagcaacagatgttgctgcatgagggccggttgtgcaagcatgaggtg
cagttgcgcctttcctatgtctatgactggtcagctccaccctcccagtgctgccagcgc
aaggagggcgttccctga

DBGET integrated database retrieval system