KEGG   Mus musculus (mouse): 117600
Entry
117600            CDS       T01002                                 

Gene name
Srgap1, 4930572H05Rik, Arhgap13
Definition
(RefSeq) SLIT-ROBO Rho GTPase activating protein 1
  KO
K07526  SLIT-ROBO Rho GTPase activating protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    117600 (Srgap1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    117600 (Srgap1)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Bin/Amphiphysin/Rvs (BAR) family proteins
   F-BAR proteins
    117600 (Srgap1)
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    117600 (Srgap1)
SSDB
Motif
Pfam: RhoGAP FCH SH3_1 SH3_9 SH3_2 FTZ Caskin-Pro-rich YoaP
Other DBs
NCBI-GeneID: 117600
NCBI-ProteinID: NP_001229340
MGI: 2152936
Ensembl: ENSMUSG00000020121
Vega: OTTMUSG00000032486
UniProt: Q91Z69
Structure
PDB: 
2GNC

Position
10; 10 D2
AA seq 1062 aa
MSTPSRFKKDKEIIAEYESQVKEIRAQLVEQQKCLEQQTEMRVQLLQDLQDFFRKKAEIE
TEYSRNLEKLAERFMAKTRSTKDHQQFKKDQNLLSPVNCWYLLLNQVRRESKDHATLSDI
YLNNVIMRFMQISEDSTRMFKKSKEIAFQLHEDLMKVLNELYTVMKTYHMYHSESISAES
KLKEAEKQEEKQIGRSGDPVFHIRLEERHQRRSSVKKIEKMKEKRQAKYSENKLKSIKAR
NEYLLTLEATNASVFKYYIHDLSDLIDCCDLGYHASLNRALRTYLSAEYNLETSRHEGLD
IIENAVDNLEPRSDKQRFMEMYPAAFCPPMKFEFQSHMGDEVCQVSAQQPVQAELMLRNQ
QLQSRLATLKIESEEVKKTTEATLQTIQDMVTIEDYDVSECFQHSRSTESVKSTVSETYL
SKPSIAKRRANQQETEQFYFMKLREFLEGSNLITKLQAKHDLLQRTLGEGHRAEYMTTSR
GRRNSHARHQDSGQVIPLIVESCIRFINLYGLQHQGIFRVSGSQVEVNDIKNSFERGENP
LSDEQSNHDINSVAGVLKLYFRGLENPLFPKERFTDLISCIRIDNLYERALHIRKLLLTL
PRSVLIVMRYLFAFLNHLSQYSDENMMDPYNLAICFGPTLMPVPEIQDQVSCQAHVNEIV
KTIIIHHETIFPDAKELDGPVYEKCMAGGDYCDSPYSEHGTLEEVDQDAGTEPHTSEDEC
EPIEAIAKFDYVGRSARELSFKKGASLLLYHRASEDWWEGRHNGIDGLVPHQYIVVQDMD
DTFSDTLSQKADSEASSGPVTEDKSSSKDMNSPTDRHSDSYLARQRKRGEPPPPGRRPGR
TSDGHCPLHPPHALSNSSIDLGSPNLASHPRGLLQNRGLNNDSPERRRRPGHGSLTNISR
HDSLKKIDSPPIRRSTSSGQYTGFNDHKPLDPETIAQDIEETMNTALNELRELERQSTVK
HAPDVVLDTLEQVKNSPTPATSTESLSPLHNVALRGSEPQIRRSTSSSSETMSTFKPMVA
PRMGVQLKPPALRPKPAVLPKTNPTMGPAAPSQGPTDKSCTM
NT seq 3189 nt   +upstreamnt  +downstreamnt
atgtccaccccgagcagattcaagaaggacaaagagatcatagccgagtatgaaagtcaa
gtcaaagaaatccgagcccagctggtagaacaacaaaaatgcctggagcagcagacagag
atgcgagttcagctgctccaggacctacaagatttcttccggaaaaaagccgaaattgag
acggaatattctcggaacctggagaagctggcagaaaggttcatggccaaaacaagaagc
actaaggaccatcaacagttcaagaaagaccaaaacctgttgtctccagtgaactgctgg
tatttgctcctgaaccaagtgagaagagagagcaaagaccacgccactttgagtgacatc
tatctgaacaatgtcatcatgcggttcatgcagataagcgaggactccacccggatgttt
aaaaagagcaaagagattgcgttccagcttcacgaggacctcatgaaggttctgaatgag
ctctacacggtgatgaaaacctaccacatgtaccactcagagagcatcagtgcagagagt
aagctgaaagaagccgagaaacaagaggagaagcagattgggaggtccggcgacccagtc
ttccacattaggctggaagagaggcatcagaggcggagctctgtgaagaaaattgaaaaa
atgaaggaaaagagacaagcaaaatattcagaaaataagctgaaatcgatcaaagcccgc
aacgagtatctcctaacacttgaagcaaccaacgcctccgtgttcaagtattacatccat
gatctttcagacttaatagactgctgtgatctcggctaccatgcaagtctgaacagagcc
ctcagaacgtacctctcggcggagtacaaccttgaaacctccagacacgaaggcttagac
atcattgaaaacgctgtggacaatttagagcccaggagtgacaagcagaggttcatggag
atgtaccctgcggcattctgcccgccaatgaaattcgagtttcagtctcacatgggtgat
gaggtgtgtcaggtcagcgcccagcagcccgtccaggcggagctcatgctcaggaaccaa
cagctgcagtcccgactggccacactcaagatcgagagcgaggaggtcaagaaaacgaca
gaagccaccctccagacgatccaagatatggtcaccattgaggactatgatgtgtctgag
tgtttccagcacagccgatccacagagtctgtgaagtccactgtgtcagaaacctacctg
agtaaacccagcatcgccaagagacgagccaaccagcaagaaacggagcagttctacttc
atgaaacttcgagagttcctggaaggcagtaacctcatcacaaagctgcaggctaagcat
gacttgctgcagaggactcttggagaaggccatagagctgaatatatgactacaagccgg
ggacgaaggaactctcacgcaagacatcaggactcaggccaggttatccctctcattgtg
gaaagctgcatccgattcattaatctctatggccttcagcaccaggggattttcagagtg
tctggctcccaggtggaagtgaacgatatcaagaattctttcgagagaggtgagaaccct
ctgtccgatgagcagagcaaccacgatatcaactcggtggccggcgtgctgaagctgtac
ttccgagggctggaaaaccccctctttcctaaggaaaggtttactgacctgatttcctgt
atcagaatagataacctctatgagagggcgctccacatccgcaaactcctcctgaccttg
cccaggtcggtccttatagtgatgaggtacctgtttgccttcctcaatcacctctcccag
tacagtgacgagaacatgatggacccttacaatctggccatttgcttcggcccaacactg
atgccggttccagagatacaggaccaagtgtcttgccaggcacacgtgaacgagattgtg
aagaccatcatcatccatcacgagactattttcccagatgctaaagaactggacggcccc
gtgtatgagaaatgcatggccggaggcgactactgcgacagcccctacagtgagcatggt
acattggaggaggtggaccaagacgccggcacagagccccacaccagtgaagacgagtgt
gagcccatcgaagccatagccaagtttgactacgtcgggcggtcagctagagagctgtcc
ttcaagaagggtgcatccctgctgctgtatcaccgagcctccgaggattggtgggaaggc
agacacaacgggatcgatggccttgtgcctcatcagtacatagttgtgcaagatatggac
gatacattttcagacacgctgagccaaaaggccgacagcgaagccagcagcgggccagtc
actgaagacaagtcctcatccaaggacatgaactccccgactgaccgccattctgatagc
tatttagccagacaaagaaagagaggagagccaccccctccgggaagacgtcccggcagg
accagcgatggccattgtcccctgcatcccccgcatgctctgtctaactcctcaattgat
ctgggatccccaaacctagccagtcaccccaggggcctgttgcagaaccgtggcctcaat
aatgacagtcctgagaggcggcgccggccgggccacggcagcctgaccaatatcagccgg
catgactccctcaagaagatcgacagccctcctatccggaggtccacatcatcagggcag
tacacaggcttcaatgaccacaagccactggaccccgagacgattgctcaggatattgag
gagaccatgaacactgctttgaacgaactccgtgaactcgagaggcagagcacagtgaag
cacgcccccgatgtcgtgctagacactttggagcaagtgaagaactcgcccacccctgcg
acttccacagaatcactcagcccactgcacaatgtcgccctcaggggctcagagccacag
attcgccggagcaccagctcctccagcgagacaatgagtactttcaagcctatggtggcg
ccccggatgggcgtccagctgaagcccccagcccttaggccaaagcctgctgttcttcca
aaaacaaaccctacgatgggacctgccgcaccttcccagggtcccacagacaagtcttgc
acgatgtaa

DBGET integrated database retrieval system