KEGG   Mus musculus (mouse): 117606
Entry
117606            CDS       T01002                                 

Gene name
Boc, 4732455C11, mFLJ00376
Definition
(RefSeq) biregional cell adhesion molecule-related/down-regulated by oncogenes (Cdon) binding protein
  KO
K20020  brother of CDO
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04340  Hedgehog signaling pathway
mmu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    117606 (Boc)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    117606 (Boc)
SSDB
Motif
Pfam: Ig_3 I-set Ig_2 ig fn3 ISET-FN3_linker V-set Ig_4 Ig_5 C2-set_2 C1-set Izumo-Ig Y_Y_Y
Other DBs
NCBI-GeneID: 117606
NCBI-ProteinID: NP_766094
MGI: 2151153
Ensembl: ENSMUSG00000022687
Vega: OTTMUSG00000014980
UniProt: Q6AZB0 D3Z763
Structure
PDB: 
1X4Y 1X4Z

Position
16; 16 B4
AA seq 1110 aa
MTTCRRERPILTLLWILMATAGCLADLNEVPQVTVQPMSTVQKLGGTVILGCVVEPPWMN
VTWRFNGKELNGSDDALGVFITRGTLVIAALNNHTVGRYQCVARMPAGAVASVPATVTLA
NLQDFKLDVQHVIEVDEGNTAVIACHLPESHPKAQVRYSVKQEWLEASRDNYLIMPSGNL
QIVNASQEDEGMYKCAAYNPVTQEVKTSGSGDRLRVRRSTAEAARIIYPLEAQTVIVTKG
QSLILECVASGIPPPRVTWAKDGSSIAAYNKTRFLLSNLLIDTTSEEDSGTYRCMASNGV
GDPGAAVILYNVQVFEPPEVTVELSQLVIPWGQSAKLTCEVRGNPPPSVLWLRNAVPLTS
SQRLRLSRRALRVVSVGPEDEGVYQCMAENAVGSAHAVVQLRTARPDTTLRPGRDTKPIA
ATPPMPPSRPSRPDQMLREQPGLVKPPTSSVQPTSLKCPGEEQVAPAEAPIILSSPRTSK
TDSYELVWRPRHEGSSRTPILYYVVKHRKVTNSSDDWTISGIPANQHRLTLTRLDPGSLY
EVEMAAYNCAGEGQTAMVTFRTGRRPKPEIVASKEQQIQRDDPGASLQSSSQPDHGRLSP
PEAPDRPTISTASETSVYVTWIPRGNGGFPIQSFRVEYKKLKKVGDWILATSAIPPSRLS
VEITGLEKGISYKFRVRALNMLGESEPSAPSRPYVVSGYSGRVYERPVAGPYITFTDAVN
ETTIMLKWMYIPASNNNTPIHGFYIYYRPTDSDNDSDYKKDMVEGDRYWHSISHLQPETS
YDIKMQCFNEGGESEFSNVMICETKARKFSGQPGRPPPLTLAPPQPPPLETMERPVGTGA
MVARASDLPYLIVGVVLGSIVLIIVTFIPFCLWRAWSKQKHTTDLGFPRSALLSSSCQYT
MVPLEGLPGHQANGQPYLGGVSGRACVSRVHGSRGCPAATVGCPGRKPQQHCPGELAQQR
EDTNSQLRQPIVSNGYDLQNQQVARGPQCASGVGAFLYTLPDDSTHQLLQPQDCCHLQKQ
PVTTCQTAVRRTSESPGLESSWDPPYHSGPQCCLGLVPVEEVDSSDSCQVGGGDWSSQHP
SGTYTGQERGMRFSPSPSVHVSFETPPPTI
NT seq 3333 nt   +upstreamnt  +downstreamnt
atgacgacgtgccgaagagagcggcctatacttacactgctttggattctcatggccaca
gcaggctgccttgctgatttgaatgaggttcctcaggtcacagtccagcccatgtccact
gtccagaagctgggaggaactgtgatcctgggctgtgtggtggagccaccatggatgaac
gtgacttggcgcttcaacggaaaggagctaaatggctctgatgatgctctgggtgtcttc
atcacccgtgggacccttgtcattgctgccctcaacaaccacactgtgggacggtaccag
tgtgtggcacggatgcctgcaggagctgtggccagtgtgccagccacagtgacgctagcc
aatctccaggactttaaattagatgtgcagcatgtgattgaagtagacgaggggaacaca
gccgtcattgcctgccacctgcctgagagccacccaaaagcccaggtccggtacagtgtc
aaacaggagtggctggaggcctctagagacaactacctgatcatgccatccgggaatctc
caaattgtcaatgccagccaagaggacgaaggcatgtacaagtgtgccgcctacaacccg
gtgacccaggaagtgaaaacctccggctccggcgacaggctgcgcgtgcgccggtccact
gctgaggctgcccgcatcatctacccactggaagcccagaccgtcattgtcaccaaaggc
cagagtctcatactggagtgtgtggccagtggaatcccaccacctcgagtcacatgggcc
aaggatgggtccagcattgctgcctataacaagactcgcttcctgctgagtaatttgctt
attgacaccaccagcgaggaggactcaggcacctaccgatgtatggccagcaatggggtt
ggggatcctggggcagcagtcatcctctacaatgtccaggtgttcgaaccccctgaggtc
acggtggagctgtcccagctggtcatcccatggggccagagtgcaaagctcacctgtgag
gttcgaggaaaccccccaccctctgtactatggctgaggaatgcagtgcccctcacctcc
agccagcgcctccggctgtcacgtagagccctgcgggtggtcagtgttgggccagaggac
gaaggcgtgtaccagtgcatggctgagaatgcggttggcagtgcccacgctgtggtccaa
ctgaggaccgcccggccagacacaaccctgagacccgggagggataccaagccgattgct
gccacaccccccatgccaccctccagacccagcagacctgaccagatgcttcgggaacaa
ccggggcttgttaagcccccaacgtcgtcggtacagcctacttccctgaagtgcccggga
gaagagcaggtagcccctgcagaggcacctatcatcctcagctcaccccggacctccaag
acggactcctatgagctggtgtggcggcctcgccatgaggggagcagccggacacccatc
ctgtactacgtagtgaagcatcgtaaggtcacgaactcctctgacgactggaccatttct
ggcattccagccaaccagcaccgcctcaccctgaccaggcttgaccctggaagcttgtac
gaagtggagatggcagcctacaactgtgctggcgagggccagacagctatggtcaccttc
cgaacaggacggcggcccaaacctgagatcgtggccagtaaggagcagcagatccagaga
gatgaccctggtgccagtctccagagcagcagccagcctgaccatggccgcctctccccc
ccagaagctccagacagacccaccatctccacagcttctgagacctccgtgtacgtaacc
tggattccccgagggaacggcggcttcccgattcagtctttccgtgtagagtacaagaag
ctaaaaaaagtgggagattggatactggctaccagtgccatacctccctcgaggctctct
gtggagatcacaggcctagagaaaggtatttcttacaagttccgagttcgtgctttgaac
atgttaggggagagtgagcccagtgctccctcccggccctacgtggtgtcaggctacagt
ggccgtgtatatgagaggcccgtggcaggaccttacatcaccttcactgatgcagtcaat
gagaccactattatgctcaagtggatgtatatcccagccagtaacaacaacaccccaatc
catggcttctatatctactaccgacccacagacagtgacaatgacagtgactacaagaag
gacatggtagaaggggacaggtactggcactccatcagccacctgcagccagagacttcc
tatgacattaaaatgcagtgcttcaatgaaggaggggagagcgagttcagcaatgtcatg
atctgcgagaccaaagctcggaaattttctggtcagcctggaagacccccacccttgact
ctagctccaccacagcctccgcccctagaaaccatggaacggccggtgggcactggagcc
atggtggcacgggccagcgacctgccctatctgattgtcggggttgttctgggctctata
gtcctcatcatcgtcaccttcatccccttctgcctatggagggcctggtctaagcagaaa
cacacaacagatctgggttttcctcggagtgccctcctgtcttcttcgtgccagtacaca
atggtgccattggagggacttccaggtcaccaagccaacgggcagccctaccttggtggc
gtcagtggacgggcctgtgtcagtcgagtgcacggaagcaggggctgccctgctgctaca
gtgggctgtccaggcaggaagcctcagcagcactgcccaggggagcttgcccagcagcgg
gaagacaccaacagccaactgaggcagcccattgttagcaacggatatgacctccagaac
cagcaggttgccagaggtccccagtgtgcctcaggagtaggagctttcttatacacgctg
cctgatgactcaactcaccagctgctccaacctcaagactgctgtcacctccagaagcaa
cccgtcaccacatgccaaacagcagtgaggcgaacgtctgaaagtcctggactagaatct
tcatgggaccctccatatcattcagggccccagtgctgtttaggtcttgtaccagttgaa
gaagtagacagttctgactcctgccaagtgggtggaggagactggagttcccagcatcca
tcagggacctacacaggacaggaacgtgggatgcggttctcgcctagcccatcagttcat
gtgtcctttgaaacaccacctcccacaatttag

DBGET integrated database retrieval system