KEGG   Mus musculus (mouse): 11761
Entry
11761             CDS       T01002                                 

Gene name
Aox1, AI196512, AI255253, Ao, Aox, Aox-1, Aox-2, Aox2, Moro, Ro
Definition
(RefSeq) aldehyde oxidase 1
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00280  Valine, leucine and isoleucine degradation
mmu00350  Tyrosine metabolism
mmu00380  Tryptophan metabolism
mmu00750  Vitamin B6 metabolism
mmu00760  Nicotinate and nicotinamide metabolism
mmu00830  Retinol metabolism
mmu00982  Drug metabolism - cytochrome P450
mmu01100  Metabolic pathways
mmu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    11761 (Aox1)
   00350 Tyrosine metabolism
    11761 (Aox1)
   00380 Tryptophan metabolism
    11761 (Aox1)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    11761 (Aox1)
   00760 Nicotinate and nicotinamide metabolism
    11761 (Aox1)
   00830 Retinol metabolism
    11761 (Aox1)
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    11761 (Aox1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    11761 (Aox1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     11761 (Aox1)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 Ald_Xan_dh_C Fer2_2 CO_deh_flav_C Fer2
Other DBs
NCBI-GeneID: 11761
NCBI-ProteinID: NP_033806
MGI: 88035
Ensembl: ENSMUSG00000063558
Vega: OTTMUSG00000029784
UniProt: O54754 G3X8P9
Position
1 C1.3; 1 28.86 cM
AA seq 1333 aa
MDPIQLLFYVNGQKVVEKNVDPEMMLLPYLRKNLRLTGTKYGCGGGGCGACTVMISRYNP
STKAIRHHPVNACLTPICSLHGTAVTTVEGLGNTRTRLHPIQERIAKCHGTQCGFCTPGM
VMSMYALLRNHPEPTLDQLTDALGGNLCRCTGYRPIIDACKTFCKASGCCQSKENGVCCL
DQEINGLAESQEEDKTSPELFSEEEFLPLDPTQELIFPPELMRIAEKQPPKTRVFYGERV
TWISPVTLKELVEAKFKYPQAPIVMGYTSVGPEVKFKGVFHPIIISPDRIEELGVISQAR
DGLTLGAGLSLDQVKDILADIVQKLPEEKTQTYRALLKHLRTLAGSQIRNMASLGGHIVS
RHLDSDLNPLLAVGNCTLNLLSKDGERRIPLSEEFLRKCPEADLKPQEVLVSVNIPWSRK
WEFVSAFRQAQRQQNALAIVNSGMRVLFREGGGVIEELSILYGGVGSTIISAKNSCQRLI
GRPWNEGMLDTACRLVLDEVTLAASAPGGKVEFKRTLIISFLFKFYLEVSQGLKREDPGH
SPSLAGNHESALDDLHSKHPWRTLTHQNVDPAQLPQDPIGRPIMHLSGIKHATGEAIYCD
DMPAVDRELFLTFVTSSRAHAKIVSIDLSEALSLPGVVDIITADHLQEANTFGTETFLAT
DEVHCVGHLVCAVIADSETRAKQAAKQVKVVYQDLAPLILTIEEAIQHKSFFKSERKLEC
GNVDEAFKIVDQILEGEIHIGGQEHFYMETQSMLVVPKGEDGEIDIYVSTQFPKYIQDIV
AATLKLSANKVMCHVRRVGGAFGGKVGKTSILAAITAFAASKHGRAVRCILERGEDMLIT
GGRHPYLGKYKAGFMNDGRILALDVEHYCNGGCSLDESLWVIEMGLLKLDNAYKFPNLRC
RGWACRTNLPSNTALRGFGFPQAGLVTEACITEVAIKCGLSPEQVRTINMYKHVDTTHYK
QEFSAKALSECWRECMAKCSYFERKAAIGKFNAENSWKKRGMAVIPLKFPVGIGSVAMGQ
AAALVHIYLDGSALVSHGGIEMGQGVHTKMIQVVSRELRMPMSSVHLRGTSTETVPNTNA
SGGSVVADLNGLAVKDACQTLLKRLEPIISKNPQGTWKDWAQTAFDQSISLSAVGYFRGY
ESNIDWEKGEGHPFEYFVFGAACSEVEIDCLTGDHKNIRTNIVMDVGHSINPALDIGQVE
GAFIQGMGLYTIEELSYSPQGTLYSRGPNQYKIPAICDIPTEMHISFLPPSEHSNTLYSS
KGLGESGVFLGCSVFFAIHDAVKAARQERGISGPWKLNSPLTPEKIRMACEDKFTKMIPR
DEPGSYVPWNIPV
NT seq 4002 nt   +upstreamnt  +downstreamnt
atggaccccattcagctgctcttctacgtgaatggccagaaggtggtagaaaaaaatgtc
gatcctgaaatgatgcttttaccatacctgaggaagaatctccgactcacaggaactaag
tatggctgtggaggcgggggctgtggggcctgcacagtgatgatctcgcggtacaacccc
agcaccaaggcgatcaggcatcatcctgtcaatgcctgtctgacccccatctgctctcta
catggtacagcagtcaccacggtagaaggcttaggcaacaccaggaccaggcttcatcct
attcaggagagaattgccaagtgtcacggcacccagtgtggattctgtactcctgggatg
gtgatgtccatgtacgcactgctcaggaaccatccagagcccactctagatcagttaact
gatgcccttggtgggaatctgtgccgctgcactggatataggcccataattgatgcctgc
aagactttctgtaaagcctctggctgctgtcaaagtaaagaaaatggggtgtgctgtttg
gatcaagaaataaatggattggcagaatcccaggaagaagataagacaagtccagaactg
ttctcagaagaggaatttctgccactggacccgacccaagagctgatatttcctcccgag
ctaatgagaatagctgagaaacagccaccaaagaccagagtgttttatggtgagagggtg
acatggatttcccccgtgactctgaaggaacttgtggaagctaaattcaagtatccccag
gcccctattgtcatggggtacacttctgtgggacctgaagtaaagtttaaaggtgtcttc
caccccatcataatttctcctgacagaattgaagagctgggtgtcataagccaggccagg
gatgggctgaccctgggtgctggcctcagcctggatcaggtgaaggacattctggctgat
atagtccagaagcttccagaagagaagacacagacataccgtgctctcctgaagcacctg
agaactctggctggctcccagatcaggaacatggcttctctagggggccacattgtgagc
agacatctggactcagatctgaatccccttctggctgtgggtaactgtaccctcaactta
ctgtccaaagatggagaacggcggatccctttaagtgaagagtttctccgaaagtgtcct
gaagcagatcttaagcctcaggaagtcttggtctcagtgaacatcccctggtccaggaag
tgggagtttgtgtcagccttccgtcaagcgcaaagacaacagaatgcactagcaatagtc
aactccggaatgagagtcctttttagagaaggaggtggcgtcattgaagagttatccatt
ttgtatggaggtgtcggttcaactatcatcagtgccaagaactcctgtcagagactcatt
gggaggccctggaatgaagggatgctggacacagcctgtaggctggttttggatgaagtc
acccttgcagcctcagctcctggtgggaaggtggagttcaagaggaccctcatcatcagc
ttccttttcaagttctacctggaggtgtcacagggtttgaagagggaggacccaggtcac
tctcctagcctggcaggcaaccatgagagtgctttagatgatcttcattcaaaacatccc
tggagaacattaacccaccagaatgtagatccagcacagctgcctcaggaccccattgga
cgtcccatcatgcacctttctgggattaaacatgccacgggcgaggccatctactgtgac
gacatgcctgcagtagaccgggagcttttcctcacttttgtaacaagttcaagagcacac
gctaagattgtgtccattgatctgtcggaagctctcagcctgcctggtgtggtggacatc
attactgcagatcatcttcaggaagcaaacaccttcggcacagagacatttctggccaca
gatgaggtacactgcgtgggccatcttgtctgtgctgtgattgcagattctgagacacgg
gcaaagcaagcggcgaagcaagtgaaggtggtctaccaagacttggcgcctctgatccta
acgattgaggaagctatacaacacaagtccttcttcaagtcagaacggaagctggagtgt
gggaatgttgacgaagcatttaaaatcgttgatcaaattcttgaaggtgaaatacacata
ggcggccaggaacatttttatatggaaacccaaagcatgcttgttgttcccaaaggagag
gatggagagattgacatctatgtgtctacacagtttcccaaatatatacaggatatagtc
gctgcaaccttgaagctctcagccaacaaggtcatgtgtcatgtaaggcgtgttggcggg
gcatttggagggaaggtgggcaagaccagcatcttggcagccatcactgcatttgctgct
agcaaacacggtcgcgcagtccgctgcattctggaacgaggagaagacatgttaataact
ggaggccgccatccttaccttggaaagtataaagctggattcatgaatgacggcagaatc
ttggccctggacgtggagcactactgcaatggagggtgctccctggatgagtcactatgg
gtgatagaaatggggcttctgaagctggacaacgcttacaagtttcccaacctacgctgc
cggggctgggcctgcagaaccaaccttccatccaacactgctctgcgtgggtttggcttt
cctcaggcagggctggtcaccgaagcctgtatcacagaagtggcaatcaaatgtggcctg
tcccctgagcaggttcgaaccataaatatgtacaagcacgttgatactacccattacaag
caagagttcagcgccaaggccctctctgagtgctggagagagtgcatggccaagtgttcc
tactttgagaggaaagcagccataggaaaattcaacgcagagaattcctggaagaagaga
ggaatggctgtgattcccctgaagtttcctgtgggtattggatcagtagccatgggacag
gcagctgccttggttcatatttatttggatggctctgcactggtctctcatggtggaatt
gagatggggcagggtgtgcacactaaaatgattcaggtggtcagccgggaactaaggatg
ccgatgtccagtgtccacctgcgtgggacaagcacagaaaccgtccccaacacaaatgcc
tctggaggctctgtggtggcagatctcaatggactggcagtaaaggatgcctgtcagacc
cttctaaaacgccttgaacccatcatcagcaagaatcctcagggaacttggaaggattgg
gcccagactgcttttgaccaaagcatcagtctctcggctgttggatatttcaggggttat
gagtcgaatatagactgggagaaaggggaaggtcatcccttcgaatactttgtgtttgga
gctgcctgctcagaggttgaaatagactgcctgactggggaccataagaatatcagaaca
aacatcgtgatggatgttggccacagcataaacccagcccttgacataggtcaggttgaa
ggtgcatttattcaaggaatgggactttacacaatagaggagctgagttactctcctcag
ggcactctatacagtcgtggtccaaaccaatacaagattcctgccatctgtgacatcccc
acggaaatgcacatttcttttttgcccccatctgaacactcaaacaccctgtattcatct
aagggcctgggagagtctggggtgtttctgggatgttcggtattttttgccatccatgat
gcagtgaaggcagcgcggcaggagagaggcatctctggaccatggaaactcaacagtcct
ctgactccagagaaaatcagaatggcctgtgaagataagttcaccaaaatgatcccaaga
gatgagcctggatcctatgttccctggaacatacctgtgtga

KEGG   Mus musculus (mouse): 213043
Entry
213043            CDS       T01002                                 

Gene name
Aox2, Aoh3, Aox, Aox3l1
Definition
(RefSeq) aldehyde oxidase 2
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00280  Valine, leucine and isoleucine degradation
mmu00350  Tyrosine metabolism
mmu00380  Tryptophan metabolism
mmu00750  Vitamin B6 metabolism
mmu00760  Nicotinate and nicotinamide metabolism
mmu00830  Retinol metabolism
mmu00982  Drug metabolism - cytochrome P450
mmu01100  Metabolic pathways
mmu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    213043 (Aox2)
   00350 Tyrosine metabolism
    213043 (Aox2)
   00380 Tryptophan metabolism
    213043 (Aox2)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    213043 (Aox2)
   00760 Nicotinate and nicotinamide metabolism
    213043 (Aox2)
   00830 Retinol metabolism
    213043 (Aox2)
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    213043 (Aox2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    213043 (Aox2)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     213043 (Aox2)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 Ald_Xan_dh_C CO_deh_flav_C Fer2_2 Fer2
Other DBs
NCBI-GeneID: 213043
NCBI-ProteinID: NP_001008419
MGI: 3529596
Ensembl: ENSMUSG00000079554
Vega: OTTMUSG00000047205
UniProt: Q5SGK3
Position
1 C1.3; 1 29.0 cM
AA seq 1345 aa
MPCPAQISDDLEFFVNGRKVTEKNVDPEVTLLAFLRKNLCLTGTKDACGTGGCGACTVMV
SQHDPVCKKTRHFSVMACLVPLCSLHGAAVTTVEGVGSIKTRLHPVQERIAKSHGTQCGF
CTPGMVMSIYTLLRNHPQPSEEQLMEALGGNLCRCTGYRPILESGRTFCMEPDGCPQKGT
GQCCLDQKESDSSGSKSDICTKLFVKDEFQPLDPTQELIFPPELLRMAENPEKQTLTFYG
ERITWIAPGTLQELLVLKAKYPEAPLISGNTALGPAMKSQGHFYPVLLSPARIPDLRMVT
KTSGGLTIGACCSLAQVKDILAESISELPQEKTQTYRALLKHLRSLAGQQIRNMASLGGH
VISRHCYSDLNPILSVGNTTLNLLSEEGPRQIPLSGHFLAGLASADLKPEEILGSVYIPH
SQKREFVSAFRQAQCHQNALPDVNAGMRVLFREGTDVIEELSIAYGGVGPTTVSAQRSCQ
QLLGRRWNALMLDEACRLLLDEVSLPGSALGGKVEFRRTLIVSLFFKFYLEVLQELKADQ
KLPPESTDSQRYPEIADRFLSSLGDFQVTLPRGVQTYQRVDSHQPLQDPVGRPIMHLSGL
KHATGEAVFCDDIPRVDKELFMALVTSTRAHARIISIDSSEVLDLPGVVDVITAEDIPGN
NGEEDDKLLAVDKVLCVGQVICAVVAETDVQAKRATEKIKITYEDLKPVIFTIEDAIKHN
SFLCPEKKLEQGNIEEAFENVDQVAEGTVHVGGQEHFYMETQRVLVIPKTEDKELDMYVS
TQDPAHVQKTVSSTLNIPISRITCHVKRVGGGFGGKVGRPAVFGAIAAVGAVKTGHPIRL
VLDREDDMLITGGRHPLFAKYKVGFMNSGRIKALDIECYINGGCTLDDSELVTEFLVLKL
ENAYKIRNLRLRGRACMTNLPSNTAFRGFGFPQGALVTESCITAVAAKCGLPPEKIREKN
MYKTVDKTIYKQAFNPDPLIRCWNECLDKSSFHIRRTRVDEFNKKSYWKKRGIAIVPMKF
SVGFAATSYHQAAALVHIYTDGSVLVAHGGNELGQGIHTKMLQVASRELKIPLSYLHICE
TSTTTVPNTIATAASVGADVNGRAVQNACQILLKRLEPVIKKNPEGTWRDWIEAAFEKRI
SLSATGYFRGYKAFMDWEKGEGDPFPYYVYGAACSEVEIDCLTGAHKKIRTDIVMDACCS
LNPAIDIGQIEGAFIQGMGLYTTEELLYSPEGVLYSRSPDKYKIPTVTDVPEQFNVSLLP
SSQTPLTLYSSKGLGESGMFLGSSVFFAIVDAVAAARRQRDIAEDFTVKSPATPEWVRMA
CADRFTDMIPRDDPKTFKPWSIPIA
NT seq 4038 nt   +upstreamnt  +downstreamnt
atgccttgcccagcccagatttcggatgatctggagttctttgtgaacgggaggaaggtg
acggagaagaatgtggacccagaagtcactctgctggccttcctgagaaagaacttatgc
ctcacaggaactaaggatgcgtgtggaacaggaggctgtggggcctgcacagtgatggtg
tcacaacacgatccggtgtgcaagaagacaagacacttctccgtcatggcatgcctggtg
cccctgtgctccctgcatggggctgctgtcaccaccgtggaaggtgtgggaagcatcaag
accaggctccaccccgtgcaggagaggatcgccaagagccacggcacccagtgtggcttc
tgcacccctgggatggtgatgtccatctacacactgctcaggaaccacccgcagccctca
gaggaacagctcatggaggccttgggagggaacctctgccgctgtactgggtatcggcca
attctggagagcggcaggaccttctgcatggagccagacggttgtccacagaaaggaaca
ggacagtgttgcttggatcagaaggaaagtgactcatcgggaagcaaaagtgatatttgc
acgaagctatttgtgaaagacgagttccagcccttggacccgacccaggagctcatattt
cccccagaactcctgaggatggctgagaacccagagaagcaaaccctaaccttttatgga
gagagaatcacctggatcgccccaggaaccctccaagaactcttggtgctgaaagctaag
taccctgaagctcctctcatctcgggcaacacagccctgggaccagccatgaagtctcaa
ggacacttttaccctgtcctcctgtctcctgctagaattcctgatctaagaatggtgact
aaaaccagtggaggactgaccataggtgcctgctgcagcctggctcaggtgaaggacatc
ttggctgagagcatctctgagctcccacaggagaaaactcagacctaccgagcactcctg
aaacacctccggagcttggcgggacagcagatccggaacatggcgtccttaggaggacat
gttataagcaggcattgctactcggacctgaatcctatcctctctgtgggcaacaccaca
ctcaatctgctgtcagaagaaggcccgcggcagattcccctcagtggacattttcttgct
gggttggcaagtgcagacctgaagcccgaggagattctggggtctgtgtacatcccacac
tctcagaagcgggagttcgtgtctgccttccggcaggcccagtgccatcagaacgccttg
cctgatgtaaatgctggcatgagagtcctgttcagagaaggcacagacgtcattgaggag
ctgagcattgcctatggaggggtggggcccaccaccgtcagcgcacaaaggtcctgccag
cagcttctgggccggcgctggaacgcactgatgctagacgaggcttgcagactgcttctg
gatgaagtctcccttccaggctcagccctgggaggcaaagtggaattcaggaggactctg
attgtcagcctcttcttcaagttctacctggaggttctgcaggaactgaaggctgaccag
aagctgcccccggagtccaccgacagccagcgttatccagagatcgcagaccggttccta
agctctctgggagatttccaggtcacgctaccccggggagtccaaacataccagagagta
gattctcaccaacctctccaagatccagttggacgtcccatcatgcacctgtcaggtctt
aaacatgccacgggggaagctgtattttgtgatgacatccctagggtggataaagaactc
ttcatggctttagtcaccagtaccagagctcatgcaagaatcatatcaatcgactcatct
gaggtccttgacctgcctggtgtggttgatgtaataacagctgaagacattccaggcaac
aatggtgaagaggatgacaaattgctggctgtagataaggttctctgtgtgggccaggtc
atctgtgccgtggtggcagagactgatgttcaggcaaaacgagcaactgagaagataaaa
atcacctacgaggatctgaaacctgtgattttcaccatcgaggatgccataaagcacaat
tcgttcctgtgccctgaaaaaaagcttgaacaaggaaacatcgaggaggcctttgagaac
gtggatcaggtagctgaagggacagtccatgttggaggacaagaacacttctacatggaa
acacagagagtgcttgttattccgaagacagaagacaaagagctagacatgtatgtgtcc
acacaggacccagcccacgtacagaaaacagtgtcctctaccttaaacatcccgatcagc
aggatcacctgccatgtgaaaagagtgggtggaggctttggaggaaaggtggggaggcca
gctgtgttcggagcaattgctgcggtgggggctgtcaaaactggccatcccattcgtctt
gttctggatcgtgaagatgatatgctaataactgggggacgacacccattatttgcaaaa
tacaaagtgggattcatgaacagtggacggatcaaagccctagacattgaatgctacatc
aatggaggctgcacattggatgactcggagctggtaacagaatttcttgtactaaaactg
gaaaatgcatacaaaatccgaaacctcagactccgaggtcgtgcctgcatgacaaactta
ccatccaatacagcttttcgtgggtttggcttccctcagggagccctggtaacagaatcc
tgcatcacagctgtggcagccaaatgtgggcttccaccagaaaagattagggagaaaaac
atgtacaaaacagttgataaaaccatctacaagcaagcgttcaaccctgaccccctgata
aggtgttggaatgagtgtctggacaagtcttcctttcacatcagaaggacaagagtggac
gagttcaataagaagagttactggaagaagcgaggcattgctattgtccccatgaagttt
tcagttggctttgctgcgacaagctaccatcaggcggctgcgctcgtccatatctacacc
gatggctctgtgttggtggcacatggaggcaatgaactggggcaaggtattcacaccaaa
atgttacaggtggccagccgtgaactgaaaatacccctgtcttatctgcatatctgtgaa
acaagtacaacaacagtgcccaatacaatcgctacagccgcgtccgttggagcggatgtc
aacggcagggctgtgcagaatgcctgtcaaatccttctcaaacgtcttgagcccgtcatt
aagaaaaacccagaagggacatggagagactggatagaagcagcttttgaaaaaagaatc
agtctttcagccactggatacttcaggggctacaaggccttcatggactgggagaaagga
gagggagacccattcccgtactatgtctatggagctgcatgttctgaggttgaaatcgac
tgcctgacaggtgctcacaagaaaatcagaaccgacattgtcatggatgcatgttgcagc
ctgaatccggccattgatattgggcagatcgaaggtgcatttattcaaggaatgggcctt
tataccaccgaggagctactctactctccagagggcgtcctgtactctcggagcccggac
aagtacaaaatcccaactgtcactgatgtcccagagcagtttaacgtgtccttgctgccg
tcctctcagaccccgctcaccctctattcgtcaaagggcctcggggagtctgggatgttc
ctagggtcatctgtgttttttgccattgttgatgcggtggctgcggcacggagacaaaga
gacatagcggaggacttcacagtgaagagcccagcaaccccagagtgggtgcggatggcc
tgtgcagatcggttcacggacatgatcccgagagatgacccaaaaacgtttaaaccttgg
tctatacctatagcttaa

KEGG   Mus musculus (mouse): 71724
Entry
71724             CDS       T01002                                 

Gene name
Aox3, 1200011D03Rik, AI326299, AO, Aoh1, Aoh2
Definition
(RefSeq) aldehyde oxidase 3
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00280  Valine, leucine and isoleucine degradation
mmu00350  Tyrosine metabolism
mmu00380  Tryptophan metabolism
mmu00750  Vitamin B6 metabolism
mmu00760  Nicotinate and nicotinamide metabolism
mmu00830  Retinol metabolism
mmu00982  Drug metabolism - cytochrome P450
mmu01100  Metabolic pathways
mmu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    71724 (Aox3)
   00350 Tyrosine metabolism
    71724 (Aox3)
   00380 Tryptophan metabolism
    71724 (Aox3)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    71724 (Aox3)
   00760 Nicotinate and nicotinamide metabolism
    71724 (Aox3)
   00830 Retinol metabolism
    71724 (Aox3)
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    71724 (Aox3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    71724 (Aox3)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     71724 (Aox3)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 CO_deh_flav_C Fer2_2 Ald_Xan_dh_C Fer2
Other DBs
NCBI-GeneID: 71724
NCBI-ProteinID: NP_076106
MGI: 1918974
Ensembl: ENSMUSG00000064294
Vega: OTTMUSG00000021877
UniProt: G3X982 Q8C6Q4 Q9CW59
Structure
PDB: 
3ZYV

Position
1 C1.3; 1 28.96 cM
AA seq 1335 aa
MSPSKESDELIFFVNGKKVTERNADPEVNLLFYLRKVIRLTGTKYGCGGGDCGACTVMIS
RYDPISKRISHFSATACLVPICSLHGAAVTTVEGIGSTKTRIHPVQERIAKGHGTQCGFC
TPGMVMSIYTLLRNHPEPSTEQIMETLGGNLCRCTGYRPIVESAKSFCPSSTCCQMNGEG
KCCLDEEKNEPERKNSVCTKLYEKKEFQPLDPTQELIFPPELMRMAEESQNTVLTFRGER
TTWIAPGTLNDLLELKMKHPSAPLVIGNTYLGLHMKFTDVSYPIIISPARILELFVVTNT
KQGLTLGAGLSLTQVKNVLSDVVSRLPKEKTQIYCALLKQLKTLAGQQIRNVASLGGHII
SRLPTSDLNPILGIGNCILNVASTEGIQQIPLNDHFLAGVPDAILKPEQVLISVFVPRSS
KWEFVSAFRQAPRQQNAFATVNAGMKVVFKEDTNTITDLGILYGGIGATVISADKSCRQL
IGRCWDEEMLDDAGKMICEEVSLLMAAPGGMEEYRKTLAISFLFMFYLDVLKQLKTRDPH
KYPDISQKLLHILEDFPLTMPYGMQSFQDVDFQQPLQDPIGRPIMHQSGIKHATGEAVFC
DDMSVLPGELFLAVVTSSKSHAKIISLDASEALASLGVVDVVTARDVPGDNGREEESLYA
QDEVICVGQIVCAVAADSYAHAQQAAKKVKIVYQDIEPMIVTVQDALQYESFIGPERKLE
QGNVEEAFQCADQILEGEVHLGGQEHFYMETQSVRVVPKGEDKEMDIYVSSQDAAFTQEM
VARTLGIPKNRINCHVKRVGGAFGGKASKPGLLASVAAVAAQKTGRPIRFILERRDDMLI
TGGRHPLLGKYKIGFMNNGKIKAADIQLYINGGCTPDDSELVIEYALLKLENAYKIPNLR
VRGRVCKTNLPSNTAFRGFGFPQGAFVTETCMSAVAAKCRLPPEKVRELNMYRTIDRTIH
NQEFDPTNLLQCWEACVENSSYYNRKKAVDEFNQQRFWKKRGIAIIPMKFSVGFPKTFYY
QAAALVQIYTDGSVLVAHGGVELGQGINTKMIQVASRELKIPMSYIHLDEMSTVTVPNTV
TTGASTGADVNGRAVQNACQILMKRLEPIIKQNPSGTWEEWVKEAFVQSISLSATGYFRG
YQADMDWEKGEGDIFPYFVFGAACSEVEIDCLTGAHKNIRTDIVMDGSFSINPAVDIGQI
EGAFVQGLGLYTLEELKYSPEGVLYTRGPHQYKIASVTDIPEEFHVSLLTPTPNPKAIYS
SKGLGEAGTFLGCSVFFAIAAAVAAAREERGLSPIWAINSPATAEVIRMACEDQFTNLVP
QTDSKCCKPWSIPVA
NT seq 4008 nt   +upstreamnt  +downstreamnt
atgtctccttctaaggagtcagatgagcttattttctttgtgaatggaaaaaaggtcacc
gagaggaatgcagaccctgaggttaatttattgttctacttgagaaaagtcatccgactc
acagggacaaagtatggctgtggaggaggtgactgtggcgcctgcacagtgatgatctca
agatacgaccccatctccaaaaggatcagtcatttctctgccactgcctgcctggttccc
atctgctctctccatggggctgctgtcactacagtagaaggcataggaagcaccaaaacc
aggatacaccctgtccaggaaaggattgccaaaggccatggtacccagtgtgggttctgc
actcccgggatggtgatgagcatctatactctcctgaggaaccacccagagccctccaca
gaacagataatggaaaccctgggcgggaatctatgccgctgcactggatacaggcccatt
gtggagagtgcgaaaagtttctgcccgagttcaacttgctgccagatgaatggggaaggg
aaatgttgcttggatgaagaaaaaaacgagcctgagagaaaaaacagtgtttgcaccaag
ttgtatgaaaaaaaagaatttcagcccttggatccaactcaggagcttatatttccacct
gagctgatgaggatggccgaggagtcccaaaatacagttctgacttttcgtggggaaagg
actacctggattgccccaggaaccctaaatgaccttctggaactgaaaatgaagcatccc
agcgctccacttgtgattggcaacacctatctggggcttcatatgaagttcacagacgta
tcttatccaattatcatctctcctgcaaggatcttagaattatttgtggtgactaataca
aagcaagggctgacactgggcgcaggcctcagcctgacccaggtgaagaacgtcttgtct
gacgtggtctccagactccctaaggagaagacgcagatatactgtgctctcctgaagcag
ctgaagaccctggctgggcagcagatcaggaatgtggcctccttaggtggtcatattatc
agtagactgccgacctctgacctcaaccctattttgggcataggcaattgcatcctcaat
gttgcctcaacagaaggaatacagcaaatccctctgaatgatcattttctcgctggagtt
ccagatgcaatcctgaagccagagcaagtgctcatctccgtttttgtgccacgctccagc
aagtgggagtttgtatcagccttcagacaggcccctcgtcagcaaaacgcgtttgcaaca
gtgaatgctggaatgaaagtcgttttcaaggaggacacaaacaccattacagacttgggg
atcttatatggagggattggtgccaccgtaatcagcgcagataagtcctgccggcagctg
attggaaggtgctgggatgaagaaatgctggatgatgctggcaagatgatttgtgaggaa
gtctccctcctgatggcagcccctggagggatggaggaataccgaaagactcttgccatc
agtttcctcttcatgttttacttagacgtgttgaagcagttaaagacgagggacccccac
aagtaccctgacatctcacagaaactcctacacattctggaagacttccctttaaccatg
ccttatgggatgcagtcatttcaggatgtagacttccaacagcctctgcaagacccaatc
ggacgtcccatcatgcatcagtctggcattaaacacgccacaggagaggcagtattttgt
gatgatatgtctgtgttgcctggggaactcttcttggcagtggtaaccagcagcaagtca
catgctaaaatcatctctcttgatgcctccgaggccttggcgtcacttggtgtggttgat
gtggtaacagctcgagatgtgcctggtgacaatggcagagaagaggaaagcctatatgca
caggatgaggtgatctgcgtgggtcaaattgtgtgtgctgtggccgctgactcttatgct
catgcccagcaggccgcaaaaaaagtgaagattgtctatcaagacatagagcccatgatt
gtgacagtgcaggatgcactgcaatatgaatcattcattggacctgaaagaaaactagaa
caaggaaatgttgaggaagcatttcaatgtgccgatcaaatcctcgaaggggaggtgcac
ttgggaggccaggagcatttttacatggagactcaaagcgtacgtgtggtccccaaggga
gaggataaggagatggacatctatgtgtcaagccaggatgctgcatttacacaggaaatg
gtggctcgcaccttgggcatcccaaagaataggatcaactgccatgtgaaaagggttggt
ggagccttcggagggaaagcaagcaagcctgggctcctggcatccgtggcagctgtagcc
gcacagaagaccggccgcccaatacgtttcattctagagcgtagggatgacatgttgata
actggaggacgtcacccactactcgggaaatacaagattggcttcatgaacaatgggaaa
atcaaggcggcagacatccagctttatatcaatggaggctgcaccccagatgattctgaa
ctggtgatagaatatgctttgctcaaactggaaaatgcttacaagatccccaacctccgt
gtccgaggtcgagtctgtaagaccaacttgccttccaatacagcgtttcgaggatttggc
tttccccagggggcatttgtaacagaaacctgtatgtccgctgtggcagccaaatgccgc
ttaccaccagagaaggttcgagagctaaacatgtacagaacaatcgataggacaattcac
aaccaagagtttgacccaacgaatctgctacagtgctgggaggcatgtgtggaaaattct
tcctactataacaggaaaaaagctgtggatgaatttaaccaacagagattttggaagaag
agaggaattgccatcatccccatgaaattctcagttggatttccaaagacattttattat
caggctgccgctttggtccagatctacacagatgggtctgtactagttgctcatggtggt
gttgaactgggacaaggtattaacaccaaaatgatacaggtggccagccgtgaattaaag
atacctatgtcttatatacacctggatgagatgagcactgtgaccgtccccaacacggtt
accactggagcatccaccggtgccgatgtcaacgggagagctgttcagaatgcctgtcag
atccttatgaagcgtctggaacccatcatcaagcagaatcctagtggtacctgggaagaa
tgggttaaggaagcttttgttcaaagcattagcctctcggccactggatattttaggggt
taccaagctgacatggactgggagaagggagaaggtgacatttttccctattttgttttt
ggagctgcctgttctgaggttgaaattgattgtctgacgggagctcacaagaacattaga
accgacattgttatggatggatcattcagtataaatcctgctgtggacataggccagatt
gaaggggcatttgttcaaggtcttggactgtatactctagaggaactgaaatattcacct
gaaggagtcctatacactcgtggtccacaccagtacaaaatagcatcagttaccgacatc
ccagaagaattccatgtatcactgttgacaccaaccccaaacccaaaagccatctactct
tctaagggccttggcgaagctggaacgtttctgggctgttctgtgttcttcgctattgcc
gcggccgtggctgcagctcgagaggagagaggcttgtccccaatttgggccataaacagc
cctgccacagcagaagtgatccgcatggcctgtgaggaccagttcacgaacctggttcca
caaacggattctaaatgctgtaagccgtggtccatcccagttgcctag

KEGG   Mus musculus (mouse): 71872
Entry
71872             CDS       T01002                                 

Gene name
Aox4, 2310003G12Rik, AO, Aoh2
Definition
(RefSeq) aldehyde oxidase 4
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00280  Valine, leucine and isoleucine degradation
mmu00350  Tyrosine metabolism
mmu00380  Tryptophan metabolism
mmu00750  Vitamin B6 metabolism
mmu00760  Nicotinate and nicotinamide metabolism
mmu00830  Retinol metabolism
mmu00982  Drug metabolism - cytochrome P450
mmu01100  Metabolic pathways
mmu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    71872 (Aox4)
   00350 Tyrosine metabolism
    71872 (Aox4)
   00380 Tryptophan metabolism
    71872 (Aox4)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    71872 (Aox4)
   00760 Nicotinate and nicotinamide metabolism
    71872 (Aox4)
   00830 Retinol metabolism
    71872 (Aox4)
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    71872 (Aox4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    71872 (Aox4)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     71872 (Aox4)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 CO_deh_flav_C Fer2_2 Ald_Xan_dh_C Fer2
Other DBs
NCBI-GeneID: 71872
NCBI-ProteinID: NP_076120
MGI: 1919122
Ensembl: ENSMUSG00000038242
Vega: OTTMUSG00000026036
UniProt: Q3TYQ9
Position
1 C1.3; 1 28.97 cM
AA seq 1336 aa
MPSVSESDELIFFVNGKKVIEKNPDPEKNLLFYTRKVLNLTGTKYSCGTGGCGACTVMVS
RYNPKTRKIHHYPATACLVPICWLHGAAITTVEGVGSIKKRVHPVQERLAKCHGTQCGFC
SPGMVMSIYTLLRNHPEPTPDQITEALGGNLCRCTGYRPIVESGKTFSQKSTVCQMKGSG
KCCMDPDEKCLESREKKMCTKLYNEDEFQPFDPSQEPIFPPELIRMAEDPNKRRLTFQGK
RTTWIIPVTLNDLLELKASYPEAPLVMGNTTVGPGIKFNDEFYPVFISPLGVPELNLMDT
TNNGVTIGAGYSLAQLKDTLDFLVSEQPKEKTKTFHALQKHLRTLAGPQIRNMATLGGHT
ASRPNFSDLNPILAAGNATINVVSREGKDRQLPLNGPFLEKLPEADLKPEEVILSIFIPY
TAQWQFVSGLRLAQRQENAFAIVNAGMSVEFEEGTNTIKDLKMFFGSVAPTVVSASQTCK
QLIGRQWDDQMLSDACQLVLQEIRIPPDAEGGMVEYRRTLIISLLFKFYLKVQRWLNEMD
PQKFPDIPGKFVSALDDFPIETPQGIQMFQCVDPKQPQKDPVGHPIMHQSGIKHATGEAI
FIDDMPPIDQELCLAVVTSTRAHAKITSLDVSEALACPGVVDVITAEDVPGENDHNGEIL
YAQSEVICVGQIICTVAADTYIHAKEAAKRVKIAYDDIEPTIITIEEALEHNSFLSPEKK
IEQGNVDYAFKHVDQIVEGEIHVEGQEHFYMETQTILAIPQTEDKEMVLHLGTQFPTHVQ
EFVSAALNVPRSRIACHMKRAGGAFGGKVTKPALLGAVCAVAANKTGRPIRFILERSDDM
LITAGRHPLLGKYKIGFMNNGEIRAADVEYYTNGGCTPDESELVIEFVVLKSENTYHIPN
FRCRGRACKTNLPSNTAFRGFGFPQATVVVEAYIAAVASKCNLLPEEVREINMYKKTSKT
AYKQTFNPEPLRRCWKECLEKSSFFARKKAAEEFNGNNYWKKRGLAVVPMKFSVAVPIAF
YNQAAALVHIFLDGSVLLTHGGCELGQGLHTKMIQVASRELNVPKSYVHFSETSTTTVPN
SAFTAGSMGADINGKAVQNACQILMDRLRPIIRKNPKGKWEEWIKMAFEESISLSATGYF
KGYQTNMDWKKEEGDPYPYYVYGAACSEVEVDCLTGAHKLLRTDIFVDAAFSINPALDIG
QVEGAFIQGMGFYTTEELKYSPKGVLYSRGPEDYKIPTITEIPEEFYVTLVHSRNPIAIY
SSKGLGEAGMFLGSSVLFAIYDAVTTARKERGLSDIFPLNSPATPEVIRMACTDQFTEMI
PRDDPSTFTPWSIHVS
NT seq 4011 nt   +upstreamnt  +downstreamnt
atgccttccgtctccgagtctgacgagctgattttttttgtgaatggaaaaaaggtcata
gagaagaaccctgaccctgaaaagaatctactgttctacaccaggaaagttctcaatctc
acaggcactaagtacagctgtggaacaggaggctgtggggcctgcactgtgatggtgtcg
agatataatccaaagaccaggaagatccaccactacccagcaacagcatgcctggtgccc
atctgctggcttcatggagcagccattaccacagtggaaggtgtggggagcatcaaaaag
agggtgcacccagtgcaggaacgacttgccaagtgtcacggcacccagtgtggcttctgc
agccctgggatggtgatgtccatctacacactgctcaggaaccacccggagccgacacct
gatcagatcacggaggctcttggagggaatttgtgccgatgcactggatatcgaccaatt
gtagaaagcgggaaaacattctcccagaagtctactgtttgccaaatgaagggatctggg
aaatgctgcatggatccagatgagaagtgtttggagagcagagagaaaaagatgtgtact
aaactgtataatgaagatgagttccagccgtttgacccatcccaggaacctatatttcct
cctgaactgattagaatggcagaagatccaaacaagaggaggctgacattccaagggaag
aggaccacctggatcatccctgtgacactgaatgacctcctggaactgaaagccagctac
cccgaagccccactcgtcatggggaacaccacagtgggacccggtattaaatttaatgat
gaattctatccagtttttatatccccacttggggttccagaactaaatcttatggacacc
acaaacaatggggtaacaataggagcaggatacagcctggcacagcttaaagataccttg
gattttctggtatcagaacaaccaaaggagaagaccaaaacctttcacgccctccagaaa
catctgaggacacttgcagggccccagattaggaatatggctactttaggaggacacact
gcaagccgtcctaatttttctgacctcaaccctattttggcagctggaaatgctaccatc
aacgtggtatctagagaaggaaaagatcgtcagctccctttaaatggccctttcctggag
aagttgcctgaggctgacttgaaaccagaagaggttatcttgtccattttcattccttac
actgctcagtggcagtttgtgtcaggactccggttggcacagcgtcaggaaaatgccttt
gctattgtcaatgctggtatgagcgtggagtttgaggaaggtacaaacacgatcaaggat
cttaagatgttctttggaagtgttgcccccactgtggtctctgcaagtcaaacctgcaag
cagctcattgggaggcaatgggacgaccaaatgctgagtgacgcatgccagctggtcctg
caggagatccgcatcccaccagatgctgagggaggcatggtggagtaccgacgcaccctc
atcatcagcttgctcttcaaattctacctcaaagtgcagcgatggctgaatgaaatggat
cctcagaagtttcctgacatcccaggaaagtttgtgagtgccctagatgacttccccata
gaaacaccccaaggaatccagatgttccagtgtgtggatcccaaacaaccccagaaagat
ccagttgggcacccaatcatgcaccagtcgggtattaaacatgccacaggggaagctata
tttattgatgacatgcctcccattgaccaagaactctgccttgccgttgtcacgagtacc
agggcccatgcaaagatcacatcacttgatgtatcagaagccctggcgtgtccaggtgtg
gttgacgtgatcacagctgaggatgtcccgggagaaaatgatcacaatggagagattctt
tatgcacagagtgaggtcatttgcgtgggtcagatcatctgcaccgtggctgctgatacc
tacatccatgcaaaagaagcagctaaacgagtgaagattgcttatgatgacatagagcca
accattatcaccatagaggaagccctagaacacaattctttcctttctcctgagaaaaaa
attgaacaaggaaatgtagactatgccttcaaacatgtggatcaaatcgttgaaggtgag
atccacgtggaagggcaggaacacttttacatggaaacgcaaaccatcctggctatccca
caaactgaagacaaagaaatggtgttacacttggggacacagtttccaacccacgtgcag
gaatttgtgtctgcagcattaaatgtcccaaggagcaggatcgcctgccacatgaaaaga
gctggaggagcatttgggggcaaagtgaccaagcctgctctactgggagctgtctgtgct
gtggctgccaacaagactggccgcccaatccgcttcatcctagaacgaagtgatgacatg
ctgataacagctggccgccacccactcctgggaaaatacaaaattgggttcatgaataat
ggagagatcagagctgctgacgttgaatattacactaatggaggatgcacccccgacgaa
tctgagctggtgatagaatttgtcgtgctgaaatctgaaaatacatatcatattccgaat
ttccggtgccggggcagggcttgcaaaacaaacttaccatctaacacggctttccgagga
tttggcttccctcaggctacggtggtcgtcgaagcatacatcgctgcggtagcatctaaa
tgtaacttactccctgaagaggttagagaaataaacatgtataagaaaactagcaagaca
gcctataagcagacgtttaatccagagcccttgcggagatgctggaaggagtgtctggag
aagtcgtcattctttgctaggaagaaggctgcagaggaatttaacggaaacaactattgg
aagaagagggggcttgctgtcgtccccatgaagttcagcgttgcggtccccatagccttc
tacaatcaggctgctgctctggtccacatcttcttagacggctctgtcctgctgacccac
ggtggctgcgagctgggacaaggcctacacactaagatgattcaggtagccagtagagaa
ctcaacgtccccaagtcgtacgtgcacttttctgaaaccagcactaccacagtgcccaac
tccgccttcactgcgggttccatgggagcagatatcaatgggaaggctgtacagaatgcc
tgccagattcttatggaccgtcttcggcccatcatcaggaaaaaccctaaaggaaaatgg
gaggaatggattaaaatggcctttgaagaatccatcagcctctcagccactggatatttc
aaaggctaccagacaaacatggactggaagaaggaggaaggtgatccctacccatactat
gtctatggcgcagcctgctctgaggttgaagtggactgtctgactggggctcacaagctc
ctgaggaccgacatcttcgtggatgctgccttcagcattaaccctgccctggatatcggg
caggttgagggagcctttatccaaggcatgggattctacaccacagaggagttgaaatac
tccccaaaaggtgtgctctattctcggggcccagaagactacaaaatccccaccatcact
gagataccagaggagttctatgtcactctggtgcattctcgaaatcccatagccatctac
tcatccaagggattgggtgaggctgggatgttcctggggtcctcagttttatttgccata
tatgatgccgtgaccactgcccgcaaggagagagggctgagcgacatcttccccttgaat
agcccagcaacacctgaagtgattcgcatggcttgtacggatcagtttactgagatgatt
cccagagatgacccttcaacattcacaccttggtccatccacgtgtcttaa

DBGET integrated database retrieval system