KEGG   Mus musculus (mouse): 11765
Entry
11765             CDS       T01002                                 

Gene name
Ap1g1, AA409002, AU041323, AW551707, Adt, Adtg, D8Ertd374, D8Ertd374e
Definition
(RefSeq) adaptor protein complex AP-1, gamma 1 subunit
  KO
K12391  AP-1 complex subunit gamma-1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04142  Lysosome
mmu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    11765 (Ap1g1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    11765 (Ap1g1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    11765 (Ap1g1)
Membrane trafficking [BR:mmu04131]
 Endosome - Golgi transport
  Others
   AP-1 complex
    11765 (Ap1g1)
SSDB
Motif
Pfam: Adaptin_N Alpha_adaptinC2 Cnd1 DUF5609 Katanin_con80
Other DBs
NCBI-GeneID: 11765
NCBI-ProteinID: NP_001288140
MGI: 101919
Ensembl: ENSMUSG00000031731
Vega: OTTMUSG00000037661
UniProt: P22892
Structure
PDB: 

Position
8 D3; 8 57.26 cM
AA seq 822 aa
MPAPIRLRELIRTIRTARTQAEEREMIQKECAAIRSSFREEDNTYRCRNVAKLLYMHMLG
YPAHFGQLECLKLIASQKFTDKRIGYLGAMLLLDERQDVHLLMTNCIKNDLNHSTQFVQG
LALCTLGCMGSSEMCRDLAGEVEKLLKTSNSYLRKKAALCAVHVIRKVPELMEMFLPATK
NLLNEKNHGVLHTSVVLLTEMCERSPDMLAHFRKLVPQLVRILKNLIMSGYSPEHDVSGI
SDPFLQVRILRLLRILGRNDDDSSEAMNDILAQVATNTETSKNVGNAILYETVLTIMDIK
SESGLRVLAINILGRFLLNNDKNIRYVALTSLLKTVQTDHNAVQRHRSTIVDCLKDLDVS
IKRRAMELSFALVNGNNIRGMMKELLYFLDSCEPEFKADCASGIFLAAEKYAPSKRWHID
TIMRVLTTAGSYVRDDAVPNLIQLITNSVEMHAYTVQRLYKAILGDYSQQPLVQVAAWCI
GEYGDLLVSGQCEEEEPIQVTEDEVLDILESVLISNMSTSVTRGYALTAIMKLSTRFTCT
VNRIKKVVSIYGSSIDVELQQRAVEYNALFKKYDHMRSALLERMPVMEKVTTNGPSEIVQ
TNGETEPAPLETKPPPSGPQPTSQANDLLDLLGGNDITPVIPTAPTSKPASAGGELLDLL
GDITLTGAPAAAPTPASVPQISQPPFLLDGLSSQPLFNDIAPGIPSITAYSKNGLKIEFT
FERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSSVVPAFNTGTITQ
VIKVLNPQKQQLRMRIKLTYNHKGSAMQDLAEVNNFPPQSWQ
NT seq 2469 nt   +upstreamnt  +downstreamnt
atgccagcccccatcagattgcgggagctgatccggaccatccggacagcccgaacccaa
gctgaggaacgagaaatgatccagaaagaatgtgctgcaatccggtcctcatttagagaa
gaagacaatacataccggtgtcggaatgtggcaaagttactatatatgcacatgctgggc
taccctgctcactttggacagttggagtgcctcaagctaatcgcctcacaaaaattcaca
gacaaacgcattggctatttaggagcaatgctattattagatgaaagacaagatgtgcat
cttctcatgaccaactgtatcaagaatgatcttaatcatagcacgcagtttgtgcagggg
ctagcactttgtaccctcggctgcatgggctcctcggagatgtgcagagatcttgcggga
gaggtagaaaagcttctgaaaacctccaactcttacttaagaaaaaaggcagcactgtgt
gctgttcacgtcatcaggaaggttcctgaacttatggagatgtttttaccagcaacaaaa
aatttattgaatgagaagaaccatggtgtccttcacacgtctgtagtcctcctcacagag
atgtgtgaacggagcccagacatgctcgcacatttcagaaagcttgtgccccaattagtt
cgtattctaaagaacctcatcatgtccggatattccccagaacatgatgtctctggtatc
agtgacccctttttgcaggtacgaattttgcggttattaagaattttaggacggaatgac
gatgattcaagtgaagctatgaatgatatattagcacaggttgccactaatacagagact
agtaaaaatgtaggaaatgctattctgtatgagacggttttgactatcatggatattaaa
tcagagagtggattgcgagttctagccataaatattcttggtcgattcttattgaacaat
gacaaaaatattagatatgttgctctgacatctctgttgaagactgtgcagacagatcat
aacgctgtacagaggcatagaagcacaattgtggactgtctgaaagatctggatgtctcc
ataaaaagacgtgcaatggaactgagttttgccctggtgaatgggaataatatccgaggc
atgatgaaagaattactttattttctggattcctgtgagccagaatttaaagctgattgt
gcatctggaatcttccttgctgcagaaaagtacgcaccttccaaacggtggcatatagat
acaattatgcgtgtcttgacaacggcaggaagttatgttcgcgatgatgcagttcctaac
ttgattcagttaataaccaacagtgtggagatgcacgcttacaccgtccagcgcctgtac
aaggcgattctcggtgactattctcaacaacccttggtacaagtggctgcgtggtgtata
ggtgaatatggcgatcttcttgtgtctggccagtgtgaagaggaagagcctattcaggtg
acagaagatgaagtgctggatattttagaaagtgtcctgatctctaatatgtccacctct
gtgacaagaggctatgctctcactgccattatgaagctgtctacccgattcacctgtact
gtaaaccgaattaagaaagtggtttccatctatgggagcagcatcgacgtagagctccag
cagagggcagtagagtacaacgcactttttaagaagtatgaccacatgaggtctgcccta
cttgaaagaatgcctgtcatggaaaaagtgaccacaaatggcccttcggagatcgtgcag
acaaatggagagacagaaccagcgcccctagagactaaaccaccaccctcagggccacaa
cccacaagccaggccaatgatctattggatttgttgggaggaaatgacataacacctgtt
atcccaactgcacctacaagcaaaccagcatcagctggtggagaacttctcgacttgcta
ggagacatcaccctgacaggtgctccagctgctgctcctacccctgcctcagtgccacag
atatcccagccccccttcttgttggatgggctttcctcacagcctctcttcaatgacatc
gctccaggcatcccctccatcacagcgtacagtaagaacggcttgaagatagagttcacc
tttgaacggtcaaacaccaaccccagcgtaacagtgataacgatacaggcctctaacagc
acagagctagacatgacggactttgttttccaggctgcagtaccaaagacattccagctg
cagcttctgtctcctagcagcagcgttgtcccagcctttaatacagggaccatcacacaa
gtcattaaagttctgaatccacagaagcaacagctgcgaatgcggatcaagctcacatat
aatcacaagggctcggcaatgcaagatctagcagaagtgaacaatttcccccctcagtcc
tggcaatga

DBGET integrated database retrieval system