KEGG   Mus musculus (mouse): 11766Help
Entry
11766             CDS       T01002                                 

Gene name
Ap1g2, Adtg2, G2ad
Definition
(RefSeq) adaptor protein complex AP-1, gamma 2 subunit
  KO
K12391  AP-1 complex subunit gamma-1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04142  Lysosome
mmu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    11766 (Ap1g2)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    11766 (Ap1g2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    11766 (Ap1g2)
Membrane trafficking [BR:mmu04131]
 Endosome - Golgi transport
  Others
   AP-1 complex
    11766 (Ap1g2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Adaptin_N Alpha_adaptinC2 Cnd1 Kinetochor_Ybp2 Sdh_cyt
Motif
Other DBs
NCBI-GeneID: 11766
NCBI-ProteinID: NP_031481
MGI: 1328307
Ensembl: ENSMUSG00000040701
Vega: OTTMUSG00000027952
UniProt: O88512 Q3U9D1
Position
14; 14 C3
AA seq 791 aa AA seqDB search
MVVHSLRLQDLIEEIRGAKTQAQEREVIQKECAQIRASFRDGDPLQRHRQLAKLLYVHML
GYPAHFGQMECLKLIASPRFTDKRVGYLGAMLLLDERHDSHLLITNSIKNDLSQGNQPVQ
GLALCTLSTMGSAEMCRDLAPEVEKLLLQPSPYVRKKAILTAVHMIRKDPELSGIFLPPC
TKLLRERHHGIQLGTVTLITELCERNPAALRHFRKVVPQLVQILRTLVTTGYSTEHSISG
VSDPFLQVQILRLLRILGRNHEESSETMNDLLAQVATNTDTSRNAGNAVLLETVLTIMAI
HSAAGLRVLAVNILGRFLLNNDKNIRYVALTSLLQLVQSDHSAVQRHRSTVVECLQETDA
SLSRRALELSLALVNSSNVRAMMQELQAFLESCPPDLRADCASGILLAAERFAPSKRWHI
DTILHVLTTAGAHVRDDAVANLTQLIGEAEELHTYSVRRLYSALAEDISQQPLVQVAAWC
IGEYGDLLLEGNCEETEPFQVEEEDVLALLEKVLQSHMSLPATRGYAITALMKLSTRLRG
DNNRIRQVVSIYGSCVDLELQQRAVEYNTLFQKYDHMRAAILEKMPLVERGDPHVKEGGK
EKQTEAQPLEVTAPAPTEPQATKLLDLLDLLGDTSEPLSSGHAQHLPPQTPSPGEALIHL
LDLPCTPPPPAPIPSVRVFEREGLQLDLSFMRPLETPALLLVTATTTNSSKEDVTHFVCQ
AAVPKSFQLQLQAPSGNTIPAQGGLPITQVFRILNPNQAPLRLKLRLTYNHSGQPVQEIF
EVDNLPVETWQ
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atggtggtgcattcgttgagacttcaggacctaatcgaagagattcgcggggccaagacg
caggcccaggaacgggaggtgatccagaaggagtgcgcccaaattcgggcctccttccgc
gatggggatcccctgcagaggcatcgccagctggccaaactgctctacgtccacatgttg
ggctaccccgcccactttggacagatggagtgcctgaaactgatcgcctcccccagattc
acagacaagagggtgggctaccttggggccatgcttctattggatgagaggcacgattcc
catctgctcatcaccaacagcatcaagaatgacctgagccaagggaaccagccagttcaa
ggcctggccctgtgtactctgagtaccatgggctctgctgagatgtgccgggacctagcc
cctgaggtggaaaagctgcttctgcagcccagtccctatgtgcggaagaaggctattttg
actgcagtgcacatgatccggaaggaccctgagctctccggcatcttcctcccaccttgt
accaaactgcttcgtgagcgtcatcatggcatccagctgggcacagtcacgctgatcacg
gagctctgtgaaagaaaccctgcagccctcaggcactttcgcaaggtagtgccgcagctg
gtacagatcctccggactctggtgactacaggatactccacggagcacagcatctctgga
gtcagcgaccccttcttgcaggtccagatactccgcctacttcggatcctgggacggaac
catgaagaaagtagcgagaccatgaacgacttgctggcccaggtcgccaccaacacagac
accagccgaaatgcaggcaacgctgtcctgttggaaacagtgcttaccatcatggccatc
cactctgctgctggcctccgggttctagctgttaacattcttggtcgtttcttgctcaac
aatgacaagaatattaggtatgtggctctgacatcattgctgcagctggtgcagtctgac
cacagtgctgtacaacgtcaccggtccactgtggtggagtgtctacaggaaacggacgcc
tcccttagcaggcgggccctggagctgagcctggctctggtgaacagctccaatgtacga
gccatgatgcaggagctgcaggcctttctggagtcctgcccccctgatcttcgggctgat
tgtgcctcaggcattctgttggctgcggagaggtttgctcccagcaagcgatggcacata
gacaccatcctgcacgtgctgaccacggcaggagcccatgtgagggatgacgcagtggcc
aacctgacccagctgattggagaggccgaggagctgcatacctactctgtgcgccgtctc
tacagtgccttagcagaggatatctcccagcaaccactggttcaggtggcagcctggtgc
attggcgagtatggggacctcctgctggaaggtaactgtgaggagacggagccttttcag
gtggaagaagaggacgtgctagcactgctggaaaaggtgctgcagtcccatatgtccctg
ccagccactcggggctacgccatcacagccctcatgaagctgagcacccgactccgggga
gacaacaatcgtattcgccaggtggtgtccatctacgggagctgtgtggacttagagctg
caacagcgggctgtggagtataacacactcttccagaagtacgaccacatgagagccgcc
atcctagaaaagatgcctcttgtagagcgtggtgacccccacgttaaagagggagggaag
gagaagcaaacggaagcccagcccttggaagtgacagcccctgcccccacagaaccccag
gccaccaaactcttagatctactggatctcctgggtgacacttcagagcctctctcttct
gggcatgcccagcatcttcctcctcagactccttccccaggggaagccttaattcatctc
cttgaccttccctgtacaccgccacccccagctcccatccccagtgtcagagtgtttgag
cgtgagggcctacagctggatctttctttcatgcggcccttggagacccctgctttgctc
ttagtcactgccaccaccaccaactcctcaaaggaggatgttacccacttcgtttgccag
gcagctgtgcccaagagtttccagctgcagttacaggcccccagtgggaacacaattcca
gctcagggtggtcttcccatcacccaggtcttcagaatcctcaatcctaaccaggcacct
ttgcgacttaagctgcgcctcacctacaaccactctggccagccagtacaggagatcttt
gaggtggataacttgcctgtggagacgtggcagtaa

DBGET integrated database retrieval system