KEGG   Mus musculus (mouse): 11767
Entry
11767             CDS       T01002                                 

Symbol
Ap1m1, AA408894, AP47, Adtm1A, Cltnm, mu1A
Name
(RefSeq) adaptor-related protein complex AP-1, mu subunit 1
  KO
K12393  AP-1 complex subunit mu
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04142  Lysosome
mmu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    11767 (Ap1m1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    11767 (Ap1m1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    11767 (Ap1m1)
Membrane trafficking [BR:mmu04131]
 Endosome - Golgi transport
  Others
   AP-1 complex
    11767 (Ap1m1)
SSDB
Motif
Pfam: Adap_comp_sub Clat_adaptor_s DUF5482
Other DBs
NCBI-GeneID: 11767
NCBI-ProteinID: NP_031482
MGI: 102776
Ensembl: ENSMUSG00000003033
Vega: OTTMUSG00000022231
UniProt: P35585 Q3UG16
Structure
Position
8:72993857..73011230
AA seq 423 aa
MSASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPILAHGGVRFMWI
KHNNLYLVATSKKNACVSLVFSFLYKVVQVFSEYFKELEEESIRDNFVIIYELLDELMDF
GYPQTTDSKILQEYITQEGHKLETGAPRPPATVTNAVSWRSEGIKYRKNEVFLDVIEAVN
LLVSANGNVLRSEIVGSIKMRVFLSGMPELRLGLNDKVLFDNTGRGKSKSVELEDVKFHQ
CVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIEKHSHSRIEYMVKAKSQ
FKRRSTANNVEIHIPVPNDADSPKFKTTVGSVKWVPENSEIVWSVKSFPGGKEYLMRAHF
GLPSVEAEDKEGKPPISVKFEIPYFTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQL
RTQ
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgtccgccagcgccgtctacgtactggatctgaagggcaaggtgctcatctgcaggaac
taccgtggggatgtggacatgtcagaggtggagcacttcatgcccattctgatggagaag
gaggaggagggcatgctgtcacctatcttggcccatggtggcgttcgtttcatgtggatt
aagcacaacaacctgtacctggtcgccacttcaaaaaagaatgcttgtgtgtcactggtg
ttctccttcctctacaaggtggtacaggtcttctccgagtactttaaggagttggaggag
gagagcatccgagacaactttgtcatcatctacgagctgctagatgagctcatggacttt
ggctacccgcagaccactgacagcaagatcttgcaggagtacatcactcaggaaggccac
aagctggaaacgggggcccctaggcccccagccacagtcaccaatgctgtgtcctggcgt
tcagaaggcatcaagtatcggaagaatgaagtattcctggatgtcattgaggctgttaac
ctcttggtcagtgccaatggcaacgtgctgcgcagtgagattgtgggttccatcaagatg
cgggtcttcctctcaggcatgcctgagttacgcctgggtctcaatgacaaggtcctcttc
gacaacacaggccgagggaagagcaagtcagtggagctggaggatgtgaaattccaccag
tgtgtgcggctgtcacgttttgagaacgaccgcactatctccttcatcccacccgacgga
gagtttgaactcatgtcctaccgcctcaacacccatgtgaagcctttgatctggattgag
tccgtgattgagaagcattcccacagccgcattgagtacatggtcaaggccaagagccag
ttcaagaggcggtcaacagccaacaatgtagagatccatataccagtccccaacgatgct
gattcacccaagttcaagactacagtggggagtgtcaagtgggtccctgaaaacagtgag
atcgtgtggtccgtcaagtcctttccgggtggcaaggagtacctgatgcgggcccacttt
ggccttcccagtgtggaagctgaagacaaggagggaaagccccccatcagcgtcaagttt
gagatcccctatttcactacctctggcatccaggtgcgctacctgaaaatcattgagaag
agtgggtaccaggccctgccctgggtacgatatatcacacagaacggagattatcagctc
cggacccagtga

DBGET integrated database retrieval system